PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G155100.1
Common NamePOPTR_0001s15490g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 303aa    MW: 33642.9 Da    PI: 8.6137
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G155100.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-19137191256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++k+q  +Lee F+++++++ +++  LAk+lgL  rqV vWFqNrRa+ k
  Potri.001G155100.1 137 RKKLRLSKDQAAILEESFKEHNTLNPKQKMALAKQLGLRPRQVEVWFQNRRARTK 191
                         788899***********************************************98 PP

2HD-ZIP_I/II130.18.6e-42137226191
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         +kk+rlsk+q+++LEesF+e+++L+p++K++la++Lgl+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+kev+eLr +l
  Potri.001G155100.1 137 RKKLRLSKDQAAILEESFKEHNTLNPKQKMALAKQLGLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCENLTEENRRLQKEVQELR-AL 226
                         69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.5E-342110IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.604.5E-19113194IPR009057Homeodomain-like
SuperFamilySSF466893.72E-19121194IPR009057Homeodomain-like
PROSITE profilePS5007117.605133193IPR001356Homeobox domain
SMARTSM003891.6E-16135197IPR001356Homeobox domain
CDDcd000863.09E-16137194No hitNo description
PfamPF000465.5E-17137191IPR001356Homeobox domain
PRINTSPR000311.5E-5164173IPR000047Helix-turn-helix motif
PROSITE patternPS000270168191IPR017970Homeobox, conserved site
PRINTSPR000311.5E-5173189IPR000047Helix-turn-helix motif
CDDcd146860.00639186225No hitNo description
PfamPF021832.3E-11193227IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.2E-27193236IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009641Biological Processshade avoidance
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009826Biological Processunidimensional cell growth
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MMAGKEDLGL SLSLSVPQNQ HSLQLNLMPS LVPSTASSSL SGFHPQKPSW NVTFPSSDPN  60
SNSYRAETRS LLRGIDVNRL PSTADCEEEA GVSSPNSTIS SISGKRSERE GINGDEHEME  120
RASSHGISDE EDGETSRKKL RLSKDQAAIL EESFKEHNTL NPKQKMALAK QLGLRPRQVE  180
VWFQNRRART KLKQTEVDCE FLKRCCENLT EENRRLQKEV QELRALKLSP QFYMQMTPPT  240
TLTMCPSCER VAAPPTASST VDARPHPHIG PTRHRPVPMN PWAPAAPVTR GPTPFDAIRP  300
RS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1135141SRKKLRL
2185193RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that plays a role in auxin-mediated morphogenesis. Negatively regulates lateral root elongation. {ECO:0000269|PubMed:12492842}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00550DAPTransfer from AT5G47370Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G155100.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By indole-3-acetic acid (IAA). {ECO:0000269|PubMed:12492842}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368991.10.0homeobox-leucine zipper protein HAT4
SwissprotP466011e-119HAT2_ARATH; Homeobox-leucine zipper protein HAT2
TrEMBLB9MUS10.0B9MUS1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s15490.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF123934105
Representative plantOGRP19616156
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.11e-117homeobox protein 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zou LJ, et al.
    Role of Transcription Factor HAT1 in Modulating Arabidopsis thaliana Response to Cucumber mosaic virus.
    Plant Cell Physiol., 2016. 57(9): p. 1879-89
    [PMID:27328697]