PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G150600.1
Common NamePOPTR_0001s15070g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 472aa    MW: 52310 Da    PI: 8.2865
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G150600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix47.73.9e-151693182
            trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyf 82
                        +Wt++e laLi+a+ +++ +++rg+l++++We+v+ ++      +s+ qC++k+e+l+kry+ +k+   +   +  s++ +f
  Potri.001G150600.1 16 CWTRDESLALIKAYCDKWYSVNRGNLRAADWEAVAVAVP----PKSSLQCRHKIEKLRKRYRVEKQKCLEYPGQFFSSWDLF 93
                        8***********************************997....589****************99987655555555556555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138372.6E-141599No hitNo description
PROSITE profilePS500906.0511769IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
METTPCATPK RVPPPCWTRD ESLALIKAYC DKWYSVNRGN LRAADWEAVA VAVPPKSSLQ  60
CRHKIEKLRK RYRVEKQKCL EYPGQFFSSW DLFPLLDSLE IGSLGSKGDQ EIDKGNDVGD  120
GFRVKTLGDR YLLTTQKNGK TNGDLDPDED FGLDPDLAFR AAKYSKVHGG FNVHGDSESG  180
FGFKSVANKN LVSVAFGPKD YVGVNGKLTA NVGLNCDNGG EFGYKVEKTR GGRKVMPQGV  240
RLPDYEMIAN NYGSYVRDFT KGVHSYGGFP LKSLGDGNYN TIDGKPTPDF CDNDDHVEID  300
YRNDKRDEFG KKVTNGWSYS PTGFRPKNCG TIDGNSRSNA RSRAVNGSVN VGMNGIGDGV  360
KRETDPISLL VSAIEQATES FVKVEMMKMD MASEIEKMRM EMGLKHNQMI LESQQRIVDT  420
LAKAMLEKKK EREKVEVRPP NSSRNGFSQV AAVEFERIGK SIVKEGEACF T*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368939.10.0hypothetical protein POPTR_0001s15070g
TrEMBLU5GPJ60.0U5GPJ6_POPTR; Uncharacterized protein
STRINGPOPTR_0001s15070.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF137971421
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44730.13e-29Trihelix family protein