PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G146200.4
Common NamePOPTR_0001s02910g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARR-B
Protein Properties Length: 537aa    MW: 59771.3 Da    PI: 6.0855
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G146200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like39.71.1e-12312345135
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilel 35 
                         k +++WtpeLH++Fv+ave+L G ++A+P++ile 
  Potri.001G146200.4 312 KMKVDWTPELHRKFVQAVEKL-GVDQAIPSRILEK 345
                         5689*****************.**********985 PP

2Response_reg30.32.1e-11201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         vl+ d++   +  +++ le  +y +v ++ + +eal  + ++   +++ ++ ++m+++  ++ +k +++++ +lp i+ ++ +  +++ ++
  Potri.001G146200.4  20 VLLLDEDSMSAAEIKSKLEAMDY-IVYTFCNETEALSAISNEPgsFHVAIVEVSMSNS--SRSFKFLETSK-DLPTIMTSSIDCLNTMMKC 106
                         79999999999************.***************999989**********984..35555565555.899**9999999******* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp ++++l++
  Potri.001G146200.4 107 IALGAVEFLRKPLSEDKLRN 126
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23008.3E-1716139No hitNo description
SuperFamilySSF521722.7E-1616134IPR011006CheY-like superfamily
SMARTSM004486.1E-418128IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011024.58319132IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-820127IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.55E-1021131No hitNo description
Gene3DG3DSA:1.10.10.602.2E-10310344IPR009057Homeodomain-like
SuperFamilySSF466891.79E-6311346IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-11312349IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MVCTTNDLSA WKDFPKGLRV LLLDEDSMSA AEIKSKLEAM DYIVYTFCNE TEALSAISNE  60
PGSFHVAIVE VSMSNSSRSF KFLETSKDLP TIMTSSIDCL NTMMKCIALG AVEFLRKPLS  120
EDKLRNIWQH VVHKAFNAGG SVQSKSLKPV KDSVVSMLEL KDGLEENENK NMEKTENVSQ  180
AQESNEQQSP ASDKYPAPST PQLKQGERLL DDGDCQDHIN CLIEKESVEQ EGDSKSVETT  240
CAMSEETLQA GDPQSFTETV IKEEDDSTDG VKSENNMCPN SQNKDTLNHS NGCAEKASSL  300
HNSHGTRANR KKMKVDWTPE LHRKFVQAVE KLGVDQAIPS RILEKYRMHR RHILPKEDER  360
QWTQHRDQVQ RSYYPHKPIM AYPPYHSNHA LPPGPVYPMW GATGSHTAGV HMWGPPGYSP  420
WPPTESCHWK PYPGMHADAW GCPVMPPHNP YSTIPHYASG FQSASMVNNS CGMPQKLFDL  480
QPAEEVIDKV VKEAINKPWL PLPLGLKPPS ADSVLAELSR QGVSSIPPRI NGSNSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.84700.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G146200.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0289200.0CT028920.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024440388.10.0two-component response regulator-like APRR2 isoform X3
SwissprotQ6LA431e-135APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A3N7E9R00.0A0A3N7E9R0_POPTR; Uncharacterized protein
STRINGPOPTR_0001s02910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-139ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]