PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G146200.17
Common NamePOPTR_0001s02910g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 482aa    MW: 53744.5 Da    PI: 6.7906
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G146200.17genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.1e-28240294156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k +++WtpeLH++Fv+ave+L G ++A+P++ile+mkv+gLt+++v+SHLQkYR++
  Potri.001G146200.17 240 KMKVDWTPELHRKFVQAVEKL-GVDQAIPSRILEVMKVEGLTRHNVASHLQKYRMH 294
                          5689*****************.********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011014.444160IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23002.6E-81367No hitNo description
SuperFamilySSF521722.11E-71462IPR011006CheY-like superfamily
PROSITE profilePS5129415.73237296IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.0E-27238297IPR009057Homeodomain-like
SuperFamilySSF466892.42E-18239297IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-25240294IPR006447Myb domain, plants
PfamPF002493.1E-8243292IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
MSNSSRSFKF LETSKDLPTI MTSSIDCLNT MMKCIALGAV EFLRKPLSED KLRNIWQHVV  60
HKAFNAGGSV QSKSLKPVKD SVVSMLELKD GLEENENKNM EKTENVSQAQ ESNEQQSPAS  120
DKYPAPSTPQ LKQGERLLDD GDCQDHINCL IEKESVEQEG DSKSVETTCA MSEETLQAGD  180
PQSFTETVIK EEDDSTDGVK SENNMCPNSQ NKDTLNHSNG CAEKASSLHN SHGTRANRKK  240
MKVDWTPELH RKFVQAVEKL GVDQAIPSRI LEVMKVEGLT RHNVASHLQK YRMHRRHILP  300
KEDERQWTQH RDQVQRSYYP HKPIMAYPPY HSNHALPPGP VYPMWGATGS HTAGVHMWGP  360
PGYSPWPPTE SCHWKPYPGM HADAWGCPVM PPHNPYSTIP HYASGFQSAS MVNNSCGMPQ  420
KLFDLQPAEE VIDKVVKEAI NKPWLPLPLG LKPPSADSVL AELSRQGVSS IPPRINGSNS  480
F*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-15245294655Transcription factor LUX
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.84700.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G146200.17
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0289200.0CT028920.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368445.20.0two-component response regulator-like APRR2 isoform X1
RefseqXP_024440369.10.0two-component response regulator-like APRR2 isoform X1
RefseqXP_024440375.10.0two-component response regulator-like APRR2 isoform X1
RefseqXP_024440380.10.0two-component response regulator-like APRR2 isoform X1
RefseqXP_024440382.10.0two-component response regulator-like APRR2 isoform X1
SwissprotQ6LA431e-114APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A2K2BXM60.0A0A2K2BXM6_POPTR; ARR-B family protein
STRINGPOPTR_0001s02910.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-118ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]