PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G137800.2
Common NamePOPTR_0001s02030g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 781aa    MW: 86562.1 Da    PI: 5.406
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G137800.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.31.7e-2087142156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e++F+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Potri.001G137800.2  87 KKRYHRHTARQIQEMEAMFKECPHPDDKQRMRLSHELGLKPRQVKFWFQNRRTQMK 142
                         688899***********************************************998 PP

2START156.12.9e-492604842206
                         HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS..............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S.. CS
               START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.............dsgealrasgvvdmvlallveellddkeqWdetla.. 77 
                         la++ ++elvk+  a+ep+W +    eng+evl  +e ++               ++ea r+++vv+m++ +lv  +ld + +W e ++  
  Potri.001G137800.2 260 LALSSMDELVKMCNANEPLWITNN--ENGKEVLNLEEHARMfpwpsnlkqnssdMRTEATRDCAVVIMNSINLVDAFLDAN-KWMELFPsi 347
                         57899*****************99..**********99888************99**************************.******999 PP

                         ..EEEEEEEECTT.....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECT CS
               START  78 ..kaetlevissg.....galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppesssvvRaellpSgiliepksn 159
                           +a+t++vi++g     g l+lm+aelq+lsplvp R+  f+R+++q  ++g+w+ivd  +ds  ++   +s+   +++pSg++i++++n
  Potri.001G137800.2 348 vaRAKTVQVIKTGvcgasGSLHLMYAELQVLSPLVPtRETHFLRFCQQnVEEGTWAIVDFPLDSFHDNI-RPSFPLYRRRPSGCVIQDLPN 437
                         99**********************************************99**************99998.56666666************* PP

                         CEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 160 ghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         g+sk+tw+eh++ +++ +h+++ + + sg+a+ga +w+a lqrqce+
  Potri.001G137800.2 438 GYSKLTWIEHAEIEDKPVHQIFSQYIYSGMAFGAHRWLAVLQRQCER 484
                         *********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.72E-2076145IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-2281152IPR009057Homeodomain-like
PROSITE profilePS5007116.95784144IPR001356Homeobox domain
SMARTSM003891.6E-1985148IPR001356Homeobox domain
CDDcd000861.05E-1887145No hitNo description
PfamPF000464.8E-1887142IPR001356Homeobox domain
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PROSITE profilePS5084840.776250487IPR002913START domain
SuperFamilySSF559611.24E-29256486No hitNo description
CDDcd088752.47E-112256483No hitNo description
SMARTSM002344.5E-29259484IPR002913START domain
PfamPF018527.0E-42261484IPR002913START domain
SuperFamilySSF559611.79E-15502745No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MFGDRQVMSN MGGNVVSSDT IYSLPIENPS FNFMSSMPFH TLSPIISKEG NGLVMPGKEE  60
VESGSGCEQL EEKSGNEEES SEQPPKKKRY HRHTARQIQE MEAMFKECPH PDDKQRMRLS  120
HELGLKPRQV KFWFQNRRTQ MKAQQDRSDN NILRAENESL QNDNYRLQAE LRNLICPDCG  180
GQAMLGEIPF EDLRLEHARL REELERVCCI ASRYGGRPIH SMSLGTCIDM MPMPMLPEPS  240
SFPEAGIVLM EEGEGLAMGL ALSSMDELVK MCNANEPLWI TNNENGKEVL NLEEHARMFP  300
WPSNLKQNSS DMRTEATRDC AVVIMNSINL VDAFLDANKW MELFPSIVAR AKTVQVIKTG  360
VCGASGSLHL MYAELQVLSP LVPTRETHFL RFCQQNVEEG TWAIVDFPLD SFHDNIRPSF  420
PLYRRRPSGC VIQDLPNGYS KLTWIEHAEI EDKPVHQIFS QYIYSGMAFG AHRWLAVLQR  480
QCERVASLMA RNISDLGVIP SPEARKNMMR LAQRMIRTFS LNISTSSGQS WTALPDSHDG  540
TVRIISREIT EPGQPNGVIL SAVSTTWLPY PHFLVFDLLR DEHRRSQLEV LSNGNALHEV  600
AHIANGSHPG NCISLLRINV ASNSSQHVDL MLQESCTDQS GSLVVFTTVD VESIQLAMSG  660
EDPSCIPLLP LGFVIVPVES SSSTVSEGNS MQSNSEDGNG NGHNNSGCLL TVGLQALAST  720
IPSAKLNFSS VTAINNHLCN TVNQITVALS NNTTTTSSCL DNSNAVGSCN EPTAAPKQQV  780
*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in the L1 of apical inflorescence meristems, early flower primordia, carpel and stamen filament epidermis, ovule primordia, nucellus and chalaze. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G137800.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU1291822e-64GU129182.1 Populus deltoides transcription factor HEX (OCLHD) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024465375.10.0homeobox-leucine zipper protein HDG5
RefseqXP_024465379.10.0homeobox-leucine zipper protein HDG5
SwissprotQ9FJS20.0HDG5_ARATH; Homeobox-leucine zipper protein HDG5
TrEMBLA0A2K2BX620.0A0A2K2BX62_POPTR; Uncharacterized protein
STRINGPOPTR_0001s02030.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Lung SC, et al.
    Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.
    New Phytol., 2018. 218(1): p. 183-200
    [PMID:29288621]