PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G137600.3
Common NamePOPTR_0001s02010g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 326aa    MW: 37054.4 Da    PI: 10.0301
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G137600.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.17.1e-32200253255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt++LH+rFv+ave LGG+e+AtPk +lelm+vk+Ltl+hvkSHLQ+YR+
  Potri.001G137600.3 200 PRMRWTTTLHARFVHAVELLGGHERATPKLVLELMDVKDLTLAHVKSHLQMYRT 253
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-15197254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28198253IPR009057Homeodomain-like
TIGRFAMsTIGR015579.5E-23200253IPR006447Myb domain, plants
PfamPF002492.9E-7201252IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNSK PTSTWRRTEE EMDLGFWKRA LDSRNSMSPM AKPDSCFELS  60
LSNPRVSEPN SNHFHNSLQN TNNCNGNSLF HSFQKNQYTH PHHKQNRLHN HHPVLFQPQQ  120
QEGLSQELGF LRPIRGIPVY QNPPPFPFSQ QTLDNTCSQD ASLATTNNTS ATTLSPYRSQ  180
GLMRSRFMSR FPAKRSMRAP RMRWTTTLHA RFVHAVELLG GHERATPKLV LELMDVKDLT  240
LAHVKSHLQM YRTVKTDRAG AAPSAQSDVF DNGSSGDTSE DFMLDIQNPR RLDISKQQGR  300
PGAHQDKDYH ALWSNSSRRT WIQSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-16201255357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-16201255458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing phloem. {ECO:0000269|PubMed:14561401}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G137600.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024461198.10.0probable transcription factor KAN2 isoform X3
SwissprotQ9C6161e-76KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A2K2BX860.0A0A2K2BX86_POPTR; Uncharacterized protein
STRINGPOPTR_0001s02010.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.11e-55G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]