PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G133400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 283aa    MW: 31654.6 Da    PI: 9.2042
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G133400.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.46.9e-332680155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Potri.001G133400.1 26 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 80
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.3992383IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-322381IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-242680IPR006447Myb domain, plants
SuperFamilySSF466894.84E-162681IPR009057Homeodomain-like
PfamPF002498.4E-92879IPR001005SANT/Myb domain
PfamPF143791.0E-22126172IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MERTTFGGGG NYPYENGMVM MTRDPKPRLR WTADLHDRFV DAVTKLGGPD KATPKSVLRL  60
MGLKGLTLYH LKSHLQKYRL GHQARRQNIS EQSRENRGAS YVNFSHGSSA TSTSSPRMDK  120
EQGEIPVAEA LDSQIEVQKT LQEQLEVQQK LQMRIEAQGK YLQSILEKAQ KSLSQNLNDD  180
GNGNLEATRA QLTGFNLAIS SLIENLNAED RKPCITDLKG VNIRTNGSAI HIDREGQTQE  240
TKDVKHHLQG DSIHFDLNTK GTYDFVAANG SELELKMLSY RR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-182679154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G133400.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024451795.10.0myb family transcription factor PHL11
SwissprotC0SVS42e-89PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A2K2BWY30.0A0A2K2BWY3_POPTR; Uncharacterized protein
STRINGPOPTR_0001s01560.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.12e-73G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]