PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G132600.1
Common NamePOPTR_0001s01480g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 343aa    MW: 38231.7 Da    PI: 8.8742
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G132600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.45.1e-2379123145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+epgrCrRtDGKkWRCs+++ +++k+CErH++r+r+rsrk++e+
  Potri.001G132600.1  79 DSEPGRCRRTDGKKWRCSKDAHPDSKYCERHMNRSRNRSRKPVES 123
                         689***************************************986 PP

2QLQ50.94.9e-181953337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        FT aQ+++L++Q+l++KyL a++ vPp+Ll++i+k
  Potri.001G132600.1 19 FTVAQWHELEHQALIFKYLKAGLSVPPYLLLPIRK 53
                        9********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.9E-101753IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.2651853IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.9E-131952IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.4579123IPR014977WRC domain
PfamPF088791.1E-1981122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MSNSSVTVAA VGPRSQPGFT VAQWHELEHQ ALIFKYLKAG LSVPPYLLLP IRKSFQLLSP  60
GFLHPSNLSY CSYFGKKIDS EPGRCRRTDG KKWRCSKDAH PDSKYCERHM NRSRNRSRKP  120
VESQTTSQSM STVASEIVTG SSSSGSRAYT TMPLPTIGNS GPLGFGSNMS RWQMESMPYG  180
VNSKDYRSLH GLKLEADEKT FLPEALGNTR SFGMNSTVDS TWHLTSQVPA SPVPESRNDA  240
LLQNYPQLRT LQDFEPLTVD DAPSKQQEEQ YLFGREFSSS GSMRQENQSL QPLFDEWPKC  300
RDMDSYFTDQ RSNKSSSGVQ LSMAIPMAPN SAPRSYHSPN DA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.84830.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G132600.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024443968.10.0growth-regulating factor 4
TrEMBLU5GUE90.0U5GUE9_POPTR; Uncharacterized protein
STRINGPOPTR_0001s01480.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.14e-39growth-regulating factor 2