PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G129900.1
Common NamePOPTR_0001s01210g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Trihelix
Protein Properties Length: 297aa    MW: 35117.6 Da    PI: 8.4658
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G129900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.51.1e-2541122186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W +qe+++ i +r e+e+++  +k++k+lWe vs kmre+g++r+p+qCk+kw+nl +ryk  ++++ +    + ++cp+f++l+
  Potri.001G129900.1  41 QWGQQETKEFIGIRAELEKDFTVTKRNKTLWEIVSVKMREKGYRRTPEQCKCKWKNLVNRYKGKETSDPE----TGRQCPFFEELH 122
                         7**************************************************************9999997....4678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.3643498IPR017877Myb-like domain
PfamPF138376.0E-2340123No hitNo description
CDDcd122035.23E-2146105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MMFSGGGEGD GLGRINMMPT AAMLSPTAEI SPRGPPQQQP QWGQQETKEF IGIRAELEKD  60
FTVTKRNKTL WEIVSVKMRE KGYRRTPEQC KCKWKNLVNR YKGKETSDPE TGRQCPFFEE  120
LHAVFTERAK NMQRLLLESE AGSTQSRKKM KRTSGDRSSD EFSEEEDEDE DDSEEEKPVR  180
SNSRKRKVEK IIAEKSPRAS SSTVGGIQEM LKEFLQQQQK MEMQWREMME RRSHERQMFE  240
QEWRQSMEKL ERERLMIEQA WREREEQRRI REESRAERRD ALLTTLLNKL IRENNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368276.10.0hypothetical protein POPTR_0001s01210g
TrEMBLU5GMR30.0U5GMR3_POPTR; Uncharacterized protein
STRINGPOPTR_0003s10360.11e-149(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Representative plantOGRP22621535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.12e-31Trihelix family protein