PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G120200.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family YABBY
Protein Properties Length: 173aa    MW: 19432.5 Da    PI: 6.9845
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G120200.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY88.42e-27101202113
               YABBY   2 dvfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesa 92 
                         d+   seq+Cyv+Cn C+t+lavsvP tslfk+vtvrCGhCt+ll vn++      a++  l+++l  + ++ l ++  n + n   ++++
  Potri.001G120200.3  10 DHLPPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLFLPSASQFPLGHNLYSPSHNLLDDQIPNPTPNFLINQTH 100
                         577899****************************************999999988888888999988886666666655555555555555 PP

               YABBY  93 stsvsseklsenedeevprvp 113
                          ++ s+ ++    d+e+pr+p
  Potri.001G120200.3 101 VNDFSV-TVRGMADHELPRPP 120
                         555544.33555666666644 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046905.7E-271470IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSSSSSLSLD HLPPSEQLCY VHCNICDTVL AVSVPCTSLF KTVTVRCGHC TNLLPVNMRG  60
LFLPSASQFP LGHNLYSPSH NLLDDQIPNP TPNFLINQTH VNDFSVTVRG MADHELPRPP  120
VIHRRENHVI LLFSLLLFYQ ESLLQFEVIN VFSLFFFLGG KCFSLRQYSL EK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.91560.0bud
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G120200.3
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006368172.15e-86axial regulator YABBY 1
TrEMBLB9N3P81e-84B9N3P8_POPTR; Uncharacterized protein
STRINGPOPTR_0001s00240.12e-85(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45190.11e-24YABBY family protein