PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G114000.2
Common NamePOPTR_0001s08310g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 178aa    MW: 19738.7 Da    PI: 10.2632
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G114000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.61.2e-24112155245
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          epgrCrRtDGKkWRCs++vl+++k+C+rH+hrgr+rsrk +e+
  Potri.001G114000.2 112 HEPGRCRRTDGKKWRCSKEVLPDQKYCDRHIHRGRQRSRKLVEA 155
                         69**************************************9985 PP

2QLQ40.96.3e-154074337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        FT  Ql++L+ Q l+yKy+ a+ PvP +L+++i+k
  Potri.001G114000.2 40 FTILQLHELELQSLIYKYIQAGFPVPYHLVLPIWK 74
                        7888******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-43874IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.2343974IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.0E-114073IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.189111155IPR014977WRC domain
PfamPF088794.6E-21113154IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MEGNRRNGRS RSPSIGLGVE LGRGGSSQRP ITGCKKPYGF TILQLHELEL QSLIYKYIQA  60
GFPVPYHLVL PIWKSVTASL GGLSSSLYQL YPSFMGCKCN PLYLEYKKGM EHEPGRCRRT  120
DGKKWRCSKE VLPDQKYCDR HIHRGRQRSR KLVEAASHSN ASTNLSISLP GIGSASA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.65170.0bud
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G114000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.21e-128growth-regulating factor 10
SwissprotQ6AWX71e-41GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9GKS41e-127B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.11e-128(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.17e-33growth-regulating factor 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]