PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G114000.1
Common NamePOPTR_0001s08310g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 203aa    MW: 22447.8 Da    PI: 10.5661
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G114000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.31.6e-24137180245
                 WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          epgrCrRtDGKkWRCs++vl+++k+C+rH+hrgr+rsrk +e+
  Potri.001G114000.1 137 HEPGRCRRTDGKKWRCSKEVLPDQKYCDRHIHRGRQRSRKLVEA 180
                         69**************************************9985 PP

2QLQ40.67.8e-156599337
                 QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                        FT  Ql++L+ Q l+yKy+ a+ PvP +L+++i+k
  Potri.001G114000.1 65 FTILQLHELELQSLIYKYIQAGFPVPYHLVLPIWK 99
                        7888******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.4E-46399IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.2346499IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-116598IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.189136180IPR014977WRC domain
PfamPF088795.8E-21138179IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MKSQAPPSKI ARLSNSRTGL LNGWNMEGNR RNGRSRSPSI GLGVELGRGG SSQRPITGCK  60
KPYGFTILQL HELELQSLIY KYIQAGFPVP YHLVLPIWKS VTASLGGLSS SLYQLYPSFM  120
GCKCNPLYLE YKKGMEHEPG RCRRTDGKKW RCSKEVLPDQ KYCDRHIHRG RQRSRKLVEA  180
ASHSNASTNL SISLPGIGSA SA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.65170.0bud
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002298083.21e-148hypothetical protein POPTR_0001s08310g
SwissprotQ6AWX71e-42GRF12_ORYSJ; Growth-regulating factor 12
TrEMBLB9GKS41e-148B9GKS4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s08310.11e-147(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-32growth-regulating factor 2