PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G088600.2
Common NamePOPTR_0001s10900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 590aa    MW: 65505.4 Da    PI: 7.3285
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G088600.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B377.21.7e-24135235198
                         EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                         f+kvlt sd++++g +++ +k+a+e+     + +++ +++l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   +
  Potri.001G088600.2 135 FCKVLTASDTSTHGGFSVLRKHATEClppldMTQPTPTQELVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDSFVFL--R 223
                         99****************************9666677789************************************************..4 PP

                         SSEE..EEEEE- CS
                  B3  87 rsefelvvkvfr 98 
                          +++el+v+v+r
  Potri.001G088600.2 224 GENGELRVGVRR 235
                         49999*****98 PP

2Auxin_resp103.62.4e-34261340183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         a+ha+st + F v+Y+Pr+  s+F+++++k+++a+++k+ vGmRfkm+fe+eds+ rr+sGt+vgv+d++p +W++SkWrsLk
  Potri.001G088600.2 261 ASHAVSTLTLFVVYYKPRT--SQFIISLNKYLEAVSNKFVVGMRFKMRFEGEDSPDRRFSGTIVGVEDFSP-HWNDSKWRSLK 340
                         689***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.96E-40125264IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.108.8E-42126250IPR015300DNA-binding pseudobarrel domain
CDDcd100174.77E-21133235No hitNo description
PROSITE profilePS5086312.308135237IPR003340B3 DNA binding domain
PfamPF023621.5E-22135235IPR003340B3 DNA binding domain
SMARTSM010195.6E-24135237IPR003340B3 DNA binding domain
PfamPF065071.4E-31261340IPR010525Auxin response factor
PfamPF023094.2E-7459513IPR033389AUX/IAA domain
SuperFamilySSF542774.02E-14470553No hitNo description
PROSITE profilePS5174527.193477558IPR000270PB1 domain
PfamPF023092.3E-7523565IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 590 aa     Download sequence    Send to blast
MMAMNRGIGG GGGGGSLSQG NSEGCGGDDL YTELWKACAG PLVDVPKRGE RVFYFPQGHM  60
EQLEASTNQE LNQRVPLFNL PSKILCRVIH TQLLAEQDTD EVYAQITLIP ESDQIEPTSP  120
DSSSSEPPRP TVHSFCKVLT ASDTSTHGGF SVLRKHATEC LPPLDMTQPT PTQELVAKDL  180
HGYEWRFKHI FRGQPRRHLL TTGWSTFVTS KRLVAGDSFV FLRGENGELR VGVRRVACQQ  240
SSMPSSVISS QSMHLGVLAT ASHAVSTLTL FVVYYKPRTS QFIISLNKYL EAVSNKFVVG  300
MRFKMRFEGE DSPDRRFSGT IVGVEDFSPH WNDSKWRSLK VQWDEPAPIP RPDRVSPWEI  360
EPCVASVPTN LSQPVTQKNK RPRPPFEIPA LGYSTPLSSK SKNDAILDPS DKGRKSEVPT  420
SYRLFGIDLV NHSSSSTPIE VPAQLMSICS VSKEQKPEQL QKSPKEIQSK QSSTSTRSRT  480
KVQMQGIAVG RAVDLTMLKG YSQLIDELEQ LFDIKGQLHP RDKWEIVYTD DEGDMMLVGD  540
DPWPEFCNMV RRIYICSSQD VKRMGPGSKL PMLPIKGEGT VLSSDSAEN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-179183627354Auxin response factor 1
4ldw_A1e-179183627354Auxin response factor 1
4ldw_B1e-179183627354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1379383KRPRP
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G088600.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022721655.10.0auxin response factor 9-like isoform X3
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A061GDF80.0A0A061GDF8_THECC; Auxin response factor
STRINGPOPTR_0001s10900.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9