PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G087900.1
Common NamePOPTR_0001s10970g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 956aa    MW: 105379 Da    PI: 5.8884
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G087900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.23.7e-29552603152
              RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         aek isle+l++yF +++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rkik++
  Potri.001G087900.1 552 AEKMISLEVLQQYFTGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKIKKV 603
                         5899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.757538623IPR003035RWP-RK domain
PfamPF020426.1E-26556603IPR003035RWP-RK domain
SuperFamilySSF542775.89E-21852943No hitNo description
Gene3DG3DSA:3.10.20.2403.0E-25859940No hitNo description
PROSITE profilePS5174520.353859941IPR000270PB1 domain
SMARTSM006661.4E-23859941IPR000270PB1 domain
CDDcd064073.51E-34860940No hitNo description
PfamPF005644.0E-16860940IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 956 aa     Download sequence    Send to blast
MELDLDLDSS WPLDQISFIS SNPMSTFLIS SSNEQPCSPL WAFSDAADDR LLAAAAGGGN  60
PNSVTESKGE NDDNSKLPSP FLGLMPIDNP DGYCIIKERM TRALRHFKES TEQHILAQVW  120
APVKNGGRYA LTTSGQPFVI DPHSNGLHQY RMVSLMYKFS VDGESDGELG LPGRVFRQKL  180
PEWTPNVQYY SSKEYSRLDH ALHYNVRGTV ALPVFEPSGQ SCVGVVELIM TSQKINYAPE  240
VDKVCKALEA VDLKSSEILD PPSTQICNEG RQNALAEILE ILTMVCETHK LPLAQTWVPC  300
MHRSVLAYGG GLKKSCTSFD GSCNGQVCMS TTDVAFYVVD AHMWGFREAC LEHHLQKGQG  360
VAGRAFFSHN LCFCPDITQF CKTEYPLVHY ARMFGLTSCF AICLRSSYTG DDDYILEFFL  420
PPSFTDSREW KTLLGSILAI MKQDFQSLQV ASGMDLEEEE GFVEMIQVST NGRLDLRLEC  480
IQIPQSTKSP PDDNALLNGP IVQIYPEKKQ LMLDLDVIKN GGSAVQADVR QTHASLTEKE  540
TKKPKERKRG KAEKMISLEV LQQYFTGSLK DAAKSLGVCP TTMKRICRQH GISRWPSRKI  600
KKVNRSLSKL KRVIESVQGT EGAFSTSSLP VAVGTISWPP NLNGRNQQNS PNSKSPEHHG  660
DKNGSPTCRT PGSDVKAGFE DQLLGCRKLS LEELTVQNRF SPELGTGSNR SKTRGGSRGE  720
SAGTPTSHGS CQGCPENESA PAKDPSVSPV HERCIKAGGS PELVLQQTRE LNLSAAYSIP  780
DAFFATEAQE QFGGMLIEDT GSSKDLSNLC PAMADAIVDE RFPESKWTDP PSSDINPTQM  840
IAALSIAMPH VTSRQEMNSV TIKATYREDM IRFRISLSSG IAKLKEEVAK RLRLEVGTFD  900
IKYLDDDHEW ILIARDADLH ECMDVSRSSN SNMIRVSVHD ANANLGSSCE STWEI*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in roots, stems, leaves, flowers and siliques. Detected in root hairs, emerging secondary roots, vascular tissues, leaf parenchyma cells and stomata. {ECO:0000269|PubMed:18826430}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in regulation of nitrate assimilation and in transduction of the nitrate signal. {ECO:0000269|PubMed:18826430}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G087900.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not regulated by the N source or by nitrate. {ECO:0000269|PubMed:18826430}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024449512.10.0protein NLP7 isoform X1
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A2K2BUQ70.0A0A2K2BUQ7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s10970.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Xu N, et al.
    The Arabidopsis NRG2 Protein Mediates Nitrate Signaling and Interacts with and Regulates Key Nitrate Regulators.
    Plant Cell, 2016. 28(2): p. 485-504
    [PMID:26744214]
  2. Karve R,Suárez-Román F,Iyer-Pascuzzi AS
    The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release.
    Plant Physiol., 2016. 171(3): p. 2101-11
    [PMID:27221617]
  3. Yu LH, et al.
    Overexpression of Arabidopsis NLP7 improves plant growth under both nitrogen-limiting and -sufficient conditions by enhancing nitrogen and carbon assimilation.
    Sci Rep, 2016. 6: p. 27795
    [PMID:27293103]
  4. Menz J,Li Z,Schulze WX,Ludewig U
    Early nitrogen-deprivation responses in Arabidopsis roots reveal distinct differences on transcriptome and (phospho-) proteome levels between nitrate and ammonium nutrition.
    Plant J., 2016. 88(5): p. 717-734
    [PMID:27419465]
  5. Yan D, et al.
    NIN-like protein 8 is a master regulator of nitrate-promoted seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 13179
    [PMID:27731416]
  6. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  7. Liu KH, et al.
    Discovery of nitrate-CPK-NLP signalling in central nutrient-growth networks.
    Nature, 2017. 545(7654): p. 311-316
    [PMID:28489820]
  8. Li Z, et al.
    The Arabidopsis CPSF30-L gene plays an essential role in nitrate signaling and regulates the nitrate transceptor gene NRT1.1.
    New Phytol., 2017. 216(4): p. 1205-1222
    [PMID:28850721]
  9. Cao H, et al.
    Overexpression of the Maize ZmNLP6 and ZmNLP8 Can Complement the Arabidopsis Nitrate Regulatory Mutant nlp7 by Restoring Nitrate Signaling and Assimilation.
    Front Plant Sci, 2017. 8: p. 1703
    [PMID:29051766]
  10. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]
  11. Karve RA,Iyer-Pascuzzi AS
    Further insights into the role of NIN-LIKE PROTEIN 7 (NLP7) in root cap cell release.
    Plant Signal Behav, 2018. 13(1): p. e1414122
    [PMID:29215953]
  12. Zhao L, et al.
    The Arabidopsis NLP7 gene regulates nitrate signaling via NRT1.1-dependent pathway in the presence of ammonium.
    Sci Rep, 2018. 8(1): p. 1487
    [PMID:29367694]