PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G086400.5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 282aa    MW: 30940.4 Da    PI: 8.1174
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G086400.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1231e-383797262
              zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                        ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lr +PvGgg+rknk+ss
  Potri.001G086400.5 37 KEQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRSIPVGGGSRKNKRSS 97
                        7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-272989IPR003851Zinc finger, Dof-type
PfamPF027014.0E-333995IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8174195IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104379IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPIEEIVV NTCSKPPALE RKVRPQKEQA LNCPRCNSTN TKFCYYNNYS  60
LTQPRYFCKT CRRYWTEGGS LRSIPVGGGS RKNKRSSASS SSSSKKLPDL ISPPTLSQTS  120
TENHKIHEGQ DLNLAFPSTQ GIRSFSELIQ FPSINENNNK TQISSSTSAS TNTSQLSALE  180
LLTGISSRGL NSFPMPVHQD PSTLYPSGFP LQDFKPTLSF SLDGLGSGYG DLQGVHETNG  240
RLLFPFEDLK QQVSSTADIE QNKEHGDSTG YWTGMLGGGS W*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G086400.5
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024443920.10.0dof zinc finger protein DOF4.6
SwissprotQ8LAP82e-73DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A3N7FWL40.0A0A3N7FWL4_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11130.11e-172(Populus trichocarpa)
STRINGPOPTR_0003s14450.11e-171(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.11e-53Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]