PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G086400.2
Common NamePOPTR_0001s11130g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Dof
Protein Properties Length: 249aa    MW: 27420.8 Da    PI: 8.2731
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G086400.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.38e-3941101262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ke+al+cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lr +PvGgg+rknk+ss
  Potri.001G086400.2  41 KEQALNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRSIPVGGGSRKNKRSS 101
                         7899******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-263393IPR003851Zinc finger, Dof-type
PfamPF027013.2E-334399IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.8174599IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104783IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MSAIFFCPYH VLEIVVKPIE EIVVNTCSKP PALERKVRPQ KEQALNCPRC NSTNTKFCYY  60
NNYSLTQPRY FCKTCRRYWT EGGSLRSIPV GGGSRKNKRS SASSSSSSKK LPDLISPPTL  120
SQTSTENHKI HEGQDLNLAF PSTQALELLT GISSRGLNSF PMPVHQDPST LYPSGFPLQD  180
FKPTLSFSLD GLGSGYGDLQ GVHETNGRLL FPFEDLKQQV SSTADIEQNK EHGDSTGYWT  240
GMLGGGSW*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed at preprocambial stages first in wide domains, and later confined to sites of vein development. {ECO:0000269|PubMed:20563990}.
UniprotTISSUE SPECIFICITY: Accumulates in the stele. {ECO:0000269|PubMed:20563990}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G086400.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011026821.11e-163PREDICTED: dof zinc finger protein DOF4.6 isoform X2
SwissprotQ8LAP86e-60DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A2K2BUI71e-174A0A2K2BUI7_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11130.11e-165(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.33e-49Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]