PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G083700.1
Common NamePOPTR_0001s11380g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family HD-ZIP
Protein Properties Length: 197aa    MW: 23014.5 Da    PI: 9.4442
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G083700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.85e-201769456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++ft+eq++ Le +Fe+++ p  + +++LA++lgL+ rqV +WFqNrRa+ k
  Potri.001G083700.1 17 KRRFTDEQIKFLEFMFESESRPESRVKQQLASELGLEPRQVAIWFQNRRARLK 69
                        468************************************************98 PP

2HD-ZIP_I/II112.72.4e-3617107393
         HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                         krr+++eq+k+LE +Fe+e++ e++ K++la+eLgl+prqva+WFqnrRAR ktkq+Ek+y+ Lk++yd l+++ e+L++e+++L  +l++
  Potri.001G083700.1  17 KRRFTDEQIKFLEFMFESESRPESRVKQQLASELGLEPRQVAIWFQNRRARLKTKQIEKEYSILKASYDVLASSFESLKREKQSLIIQLHK 107
                         9************************************************************************************988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.0E-18873IPR009057Homeodomain-like
PROSITE profilePS5007117.4591171IPR001356Homeobox domain
SMARTSM003891.2E-151375IPR001356Homeobox domain
PfamPF000461.7E-171769IPR001356Homeobox domain
CDDcd000861.44E-131772No hitNo description
Gene3DG3DSA:1.10.10.608.5E-191878IPR009057Homeodomain-like
PRINTSPR000311.1E-54251IPR000047Helix-turn-helix motif
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
PRINTSPR000311.1E-55167IPR000047Helix-turn-helix motif
PfamPF021832.6E-1671111IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MDPGTHPLSS IQKNAYKRRF TDEQIKFLEF MFESESRPES RVKQQLASEL GLEPRQVAIW  60
FQNRRARLKT KQIEKEYSIL KASYDVLASS FESLKREKQS LIIQLHKLKN RHVKQHGSRN  120
CGNQLRSSRD GRFENKDTGS ESKEKPSSPL DGNENEENRP SSDNNGRNTV NMREEIDILN  180
HTEQTDNSSQ WWEFWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16371RRARLKTKQ
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G083700.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2328150.0CU232815.1 Populus EST from severe drought-stressed opposite wood.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297947.11e-143homeobox-leucine zipper protein ATHB-7
SwissprotP468979e-37ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7
TrEMBLB9GK741e-142B9GK74_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11380.11e-143(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16057910
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46680.14e-39homeobox 7
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Zhou SF, et al.
    Membrane-associated transcription factor peptidase, site-2 protease, antagonizes ABA signaling in Arabidopsis.
    New Phytol., 2015. 208(1): p. 188-97
    [PMID:25919792]