PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G082700.1
Common NamePOPTR_0001s11480g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family GRF
Protein Properties Length: 514aa    MW: 55710.8 Da    PI: 7.7231
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G082700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC741.7e-23194237144
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                         daep+rC+RtDGKkWRCsr+v +++k+CErH h++r rsrk++e
  Potri.001G082700.1 194 DAEPWRCKRTDGKKWRCSRDVAPDQKYCERHSHKSRPRSRKPVE 237
                         79***************************************987 PP

2QLQ57.93.1e-20134169237
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                          FTaaQ+q+L++Q ++yKy++a++PvPpeLl +i+k
  Potri.001G082700.1 134 LFTAAQWQELERQTTIYKYMMASVPVPPELLIPITK 169
                         5********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.8E-12133169IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.117134169IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088809.6E-15135167IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.941194238IPR014977WRC domain
PfamPF088792.9E-19195237IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0009941Cellular Componentchloroplast envelope
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MRSSWSRTRS GVFVDDIGLG LRMQDNLESC SGSSKRSVTA MSCDHEPAAH ELSSSSCSGG  60
GGGSGPLFYS TSNHVTCLGD IKDVVASVSA SGTGTPDAIA ESKSLQYPYF ISDSSPFTFN  120
SSGEMTPSVN ERVLFTAAQW QELERQTTIY KYMMASVPVP PELLIPITKN QSNVLPPRSN  180
SSLELGIPSL NSSDAEPWRC KRTDGKKWRC SRDVAPDQKY CERHSHKSRP RSRKPVELHT  240
HDSPRTLTNN NTNTNNSNYS TNPHLFNQKP YFPSHLFMFP SAMAPSASSY DQPRSLEWLL  300
KGEILPVASN YSQEWQHLKR DSIKGNGKVY NVYGEEQPLC SNTYRGGHSL QAQRLNDHCS  360
VLSSPKSTTL ERALSPSLTQ EQETRHFIDA WSTNSGRDDI GGIGKKSYVS SSEKLVLPHS  420
ALTLSMSPGT GSETNNEGNG SAQLSSFGIM GLSDRDHQSA SGLRPQWMMS HGGSWIVSPP  480
GGPLAEALCL GISSNAKTAS NLPSPCSSSC GPN*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G082700.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1085414e-34DQ108541.1 Corchorus olitorius SSR marker J142-M13F genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297943.10.0growth-regulating factor 8 isoform X2
TrEMBLB9GK640.0B9GK64_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11480.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138941621
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.16e-41growth-regulating factor 8