PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G080300.1
Common NamePOPTR_0001s11730g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 345aa    MW: 36914 Da    PI: 10.2835
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G080300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.31.5e-1287132247
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         ++WT+eE+  ++ +   lG+g+W+ I++++  +Rt+ q+ s+ qky
  Potri.001G080300.1  87 KPWTEEEHRTFLSGLSNLGKGDWRGISKKFVITRTPSQVASHAQKY 132
                         58*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.01724IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.15781137IPR017930Myb domain
SuperFamilySSF466898.97E-1682137IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1684136IPR006447Myb domain, plants
SMARTSM007175.8E-1085135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-1185131IPR009057Homeodomain-like
PfamPF002492.1E-1187132IPR001005SANT/Myb domain
CDDcd001672.74E-888133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVKEAARKCS HCGQNGHNSR TCTKDCIKLF GVSIEKREQT IKGSASLDNI ASLDDIHGAH  60
HVDPGYSSDG VIGSKRGRTA YTRKKGKPWT EEEHRTFLSG LSNLGKGDWR GISKKFVITR  120
TPSQVASHAQ KYFLRQQASN EKKKRRSSLF DMTFKGTDLA SHQDAPKLPL IKTCGSSSQA  180
STSSASPLRK AGEDIPSQAI SPLHLINQFP LLCLHNPQVM SPTVAAGTGV SNYNPCMQRV  240
LANGRRSFPA SKAAPFVSMM NYPRAYHPYM LNSPASLAGC APCIAHQPSG IPSPSSFPQS  300
FSPQGASTSL AKMEDPLELK IGQPPKSPQG ANISSPASGA ISVI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1141145KKKRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00573DAPTransfer from AT5G61620Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G080300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002297928.10.0probable transcription factor At5g61620
TrEMBLB9GK380.0B9GK38_POPTR; Uncharacterized protein
STRINGPOPTR_0001s11730.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF138741921
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61620.14e-54MYB_related family protein