PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G066200.4
Common NamePOPTR_0001s13110g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family ARF
Protein Properties Length: 793aa    MW: 88937.5 Da    PI: 6.9789
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G066200.4genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.5e-23140241199
                         EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                         f+k lt sd++++g +++ +++a+e+      +++++  ++l+ +d++g++W++++i+r++++r++l++GW+ Fv+a++L +gD ++F   
  Potri.001G066200.4 140 FCKMLTASDTSTHGGFSVLRRHADEClppldmSLQPPA-QELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSLFVSAKKLVAGDAFIFL-- 227
                         89*****************************9666665.59************************************************.. PP

                         SSSEE..EEEEE-S CS
                  B3  86 grsefelvvkvfrk 99 
                         + +++el+v+v+r+
  Potri.001G066200.4 228 RGETEELRVGVRRA 241
                         3489999****985 PP

2Auxin_resp1188e-39266348183
          Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                         ++ha+st+s+F+v+Y+Pr+s++eF+++++k+++++k+++++GmRfkm+fe e+++e+r+sGtv+gv+++dp +Wp+SkWr+Lk
  Potri.001G066200.4 266 VWHAVSTGSMFTVYYKPRTSPAEFIIPIDKYRESVKINYAIGMRFKMKFEAEEAPEQRFSGTVIGVEEADPKKWPRSKWRCLK 348
                         79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.8E-38134255IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.41E-39134269IPR015300DNA-binding pseudobarrel domain
CDDcd100174.13E-20138240No hitNo description
PROSITE profilePS5086311.617140242IPR003340B3 DNA binding domain
SMARTSM010191.5E-21140242IPR003340B3 DNA binding domain
PfamPF023625.1E-21140241IPR003340B3 DNA binding domain
PfamPF065072.6E-35267348IPR010525Auxin response factor
SuperFamilySSF542772.99E-12665745No hitNo description
PROSITE profilePS5174525.128668750IPR000270PB1 domain
PfamPF023091.7E-7713759IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 793 aa     Download sequence    Send to blast
MINGSYSVDN KRNGIARGSS SFPVAGEGSE DALYKELWHA CAGPLVTVPR QGELVYYFPQ  60
GHIEQVEAST NQVADDQQMP AYNLPPKILC RVVNVQLKAE LDTDEVFAQV ILLPVAEQDV  120
DLVEKEDLPP PPARPRVHSF CKMLTASDTS THGGFSVLRR HADECLPPLD MSLQPPAQEL  180
VAKDLHGNEW RFRHIFRGQP RRHLLQSGWS LFVSAKKLVA GDAFIFLRGE TEELRVGVRR  240
ALSQPSNVPS SVMSSHSMHI GILATVWHAV STGSMFTVYY KPRTSPAEFI IPIDKYRESV  300
KINYAIGMRF KMKFEAEEAP EQRFSGTVIG VEEADPKKWP RSKWRCLKVR WDETSPVHRP  360
DRVSPWKIER ALAPSLDPVP GCQSKRHRSN MATSSADSSA PTKKDNEPSR HLQHKEILTL  420
RNTHAGKNYS DSKHNPAQAL FQGKDQTAFD NRKLGPDDKI PQVMHGAKLM NLTTGPGTLH  480
ESYESTHPFF ELNSDDVDRP SKLNETGMFN CHSAPLMYLG HPFNMMASRM EVHVAKDKDI  540
QQQRGSWFSP LPYADNSSHP SGSKPQHLPF QQRNKETSKD GNCKLFGFSL FGNPMAAEPA  600
IIHRHSTEKQ QQQINVASDH LKLLGSEGFL EQAKHSKHVR PEEQGNIFQA SALHSKDVQG  660
MPEGDSTRRC VKVYKQGTAV GRSLDLAKFN GYNELTAELD QIFEFHGELV APNKDWLIVF  720
TDDEGDMMLV GDDPWQEFCS MVRRIFVFTR EEINRMEPRS LNLEAEGNSQ SADQMVDLMG  780
DGTSKHLPAV SP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1653136917353Auxin response factor 1
4ldw_A1e-1653136917353Auxin response factor 1
4ldw_B1e-1653136917353Auxin response factor 1
4ldx_A1e-1653136917353Auxin response factor 1
4ldx_B1e-1653136917353Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.117330.0bud
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in the sepals and carpels of young flower buds. At stage 10 of flower development, expression in the carpels becomes restricted to the style. Also expressed in anthers and filaments. At stage 13, expressed in the region at the top of the pedicel, including the abscission zone. Expressed in developing siliques. {ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952}.
UniprotTISSUE SPECIFICITY: Expressed in the whole plant. {ECO:0000269|PubMed:10476078, ECO:0000269|PubMed:15960614}.
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. Promotes flowering, stamen development, floral organ abscission and fruit dehiscence. Functions independently of ethylene and cytokinin response pathways. May act as a repressor of cell division and organ growth. {ECO:0000269|PubMed:12036261, ECO:0000269|PubMed:15960614, ECO:0000269|PubMed:16176952, ECO:0000269|PubMed:16339187}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G066200.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2084821e-176AC208482.1 Populus trichocarpa clone JGIACSB13-H05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299344.20.0auxin response factor 2B isoform X1
RefseqXP_024445165.10.0auxin response factor 2B isoform X1
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLB9GMS50.0B9GMS5_POPTR; Auxin response factor
STRINGPOPTR_0001s13110.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.40.0auxin response factor 2
Publications ? help Back to Top
  1. Chao WS,Doğramaci M,Foley ME,Horvath DP,Anderson JV
    Selection and validation of endogenous reference genes for qRT-PCR analysis in leafy spurge (Euphorbia esula).
    PLoS ONE, 2012. 7(8): p. e42839
    [PMID:22916167]
  2. Ozerova LV,Krasnikova MS,Troitsky AV,Solovyev AG,Morozov SY
    TAS3 Genes for small ta-siARF RNAs in plants belonging to subtribe Senecioninae: occurrence of prematurely terminated RNA precursors.
    Mol. Gen. Mikrobiol. Virusol., 2013.
    [PMID:24003511]
  3. Li C, et al.
    Ectopic expression of a maize hybrid down-regulated gene ZmARF25 decreases organ size by affecting cellular proliferation in Arabidopsis.
    PLoS ONE, 2014. 9(4): p. e94830
    [PMID:24756087]
  4. Lyons R, et al.
    Fusarium oxysporum triggers tissue-specific transcriptional reprogramming in Arabidopsis thaliana.
    PLoS ONE, 2015. 10(4): p. e0121902
    [PMID:25849296]
  5. Roodbarkelari F,Du F,Truernit E,Laux T
    ZLL/AGO10 maintains shoot meristem stem cells during Arabidopsis embryogenesis by down-regulating ARF2-mediated auxin response.
    BMC Biol., 2015. 13: p. 74
    [PMID:26358077]
  6. Meng LS,Wang ZB,Yao SQ,Liu A
    The ARF2-ANT-COR15A gene cascade regulates ABA-signaling-mediated resistance of large seeds to drought in Arabidopsis.
    J. Cell. Sci., 2015. 128(21): p. 3922-32
    [PMID:26395398]
  7. Zhao S,Zhang ML,Ma TL,Wang Y
    Phosphorylation of ARF2 Relieves Its Repression of Transcription of the K+ Transporter Gene HAK5 in Response to Low Potassium Stress.
    Plant Cell, 2016. 28(12): p. 3005-3019
    [PMID:27895227]
  8. Promchuea S,Zhu Y,Chen Z,Zhang J,Gong Z
    ARF2 coordinates with PLETHORAs and PINs to orchestrate ABA-mediated root meristem activity in Arabidopsis .
    J Integr Plant Biol, 2017. 59(1): p. 30-43
    [PMID:28074634]
  9. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]
  10. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]
  11. Zhang M,Hu X,Zhu M,Xu M,Wang L
    Transcription factors NF-YA2 and NF-YA10 regulate leaf growth via auxin signaling in Arabidopsis.
    Sci Rep, 2017. 7(1): p. 1395
    [PMID:28469131]
  12. Guan C, et al.
    Spatial Auxin Signaling Controls Leaf Flattening in Arabidopsis.
    Curr. Biol., 2017. 27(19): p. 2940-2950.e4
    [PMID:28943086]
  13. Liu Z, et al.
    ARF2-ARF4 and ARF5 are Essential for Female and Male Gametophyte Development in Arabidopsis.
    Plant Cell Physiol., 2018. 59(1): p. 179-189
    [PMID:29145642]
  14. Sarkar Das S, et al.
    Expression dynamics of miRNAs and their targets in seed germination conditions reveals miRNA-ta-siRNA crosstalk as regulator of seed germination.
    Sci Rep, 2018. 8(1): p. 1233
    [PMID:29352229]