PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G020200.1
Common NamePOPTR_0001s05750g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 267aa    MW: 29494.9 Da    PI: 5.7434
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G020200.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.73.4e-1092137651
                         HHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   6 rerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                         + +r + NReA r++Rq+Kka ++ Lee+vk+L   N++L  ++++
  Potri.001G020200.1  92 KVKRPAGNREAVRKYRQKKKAHTAYLEEEVKKLRISNQQLVRKIQQ 137
                         6689999*********************************999986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.8E-1384153No hitNo description
SMARTSM003383.9E-1087154IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.85289155IPR004827Basic-leucine zipper domain
PfamPF077161.3E-1390137IPR004827Basic-leucine zipper domain
CDDcd146864.85E-1092145No hitNo description
SuperFamilySSF579593.38E-892138No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MKDYNMDDGE IELSDHVLLP NPDSSGSLQS SASVDSLLDE FLKNTRTCTH THTCNPLGPD  60
ITHTHTCYHT HTQVITSEED DDVNNREHSN SKVKRPAGNR EAVRKYRQKK KAHTAYLEEE  120
VKKLRISNQQ LVRKIQQQVI LEAEVLRLRS ILMGLRGKID TELGVLPFQN QGDATAAFKD  180
GNCGAQSTGG PMNLQCQTDL PCFHTQVVGS SSRVNIDGND KLMESWEGTC QPVILNSQAN  240
MDNMATTEGH AMDMVEALMS SASQVQ*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G020200.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299223.20.0basic leucine zipper 23
RefseqXP_024458783.10.0basic leucine zipper 23
TrEMBLB9GM570.0B9GM57_POPTR; Uncharacterized protein
STRINGPOPTR_0001s05750.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25673277
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.13e-34bZIP family protein