PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G016000.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 389aa    MW: 44134.5 Da    PI: 8.3195
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G016000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3336.94.6e-103383291300
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         e++ +rmwkd ++lkr+ker+k  ++     ++++k +++ + arrkkm r QDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++
  Potri.001G016000.2  38 EDMDRRMWKDHVKLKRIKERQKLAVQL----AEKQKLKRTYDLARRKKMLRVQDGILKYMLKLMEVCEARGFVYGIIPEKGKPVSGASDNI 124
                         89*******************987633....4678899***************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ngpaai+ky+a++ ++++ +++   r+++s+s            Ls+l+qhc+ppqr+ plek v+pPWWPtG+e+ww 
  Potri.001G016000.2 125 RAWWKEKVKFDKNGPAAIAKYEAECSAMGELNES---RNRNSQS----------DFLSSLIQHCNPPQRKHPLEKKVPPPWWPTGNEDWWL 202
                         ***************************9976666...4444433..........3699********************************* PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX...... CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss...... 265
                         +lgl++ q+ pp+kkphdlkk+wkv vLtavik+msp++ +ir+++ qsk+lqdkm+ake +++l  l+ ee+++ + s +  +s      
  Potri.001G016000.2 203 KLGLPQAQS-PPFKKPHDLKKMWKVRVLTAVIKRMSPDFCKIRRHVHQSKCLQDKMTAKECAIWLGLLSLEESLIGKPSIDtgTSviierp 292
                         ******999.9********************************************************************996522666655 PP

                         .XXXXXXXXXXXXXXXXXXXX.......XXXXXX.XXXXXXXX CS
                EIN3 266 .slrkqspkvtlsceqkedve.......gkkeskikhvqavkt 300
                            + q ++  +sc++++dv+              k+ + ++ 
  Potri.001G016000.2 293 qGGHGQIKNPAISCDSDYDVDdgvgsvsS------KDNRRNQL 329
                         4333499999***********76433221......22222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048736.8E-10138272No hitNo description
Gene3DG3DSA:1.10.3180.101.3E-55163278IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.7E-50165275IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGKLEEIGAD ICLDIEVDDI RCENIAEKDV SDEEIGAEDM DRRMWKDHVK LKRIKERQKL  60
AVQLAEKQKL KRTYDLARRK KMLRVQDGIL KYMLKLMEVC EARGFVYGII PEKGKPVSGA  120
SDNIRAWWKE KVKFDKNGPA AIAKYEAECS AMGELNESRN RNSQSDFLSS LIQHCNPPQR  180
KHPLEKKVPP PWWPTGNEDW WLKLGLPQAQ SPPFKKPHDL KKMWKVRVLT AVIKRMSPDF  240
CKIRRHVHQS KCLQDKMTAK ECAIWLGLLS LEESLIGKPS IDTGTSVIIE RPQGGHGQIK  300
NPAISCDSDY DVDDGVGSVS SKDNRRNQLM DVEPLNSQNH VQDTELGERQ LGTKKPLVRS  360
SDADEQLVLP LNDNSGAVQR NTLSDTDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-5816628422140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G016000.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142771e-122AC214277.1 Populus trichocarpa clone ACSB1145-L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024463069.10.0LOW QUALITY PROTEIN: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-154EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLB9GMA10.0B9GMA1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s05370.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-136ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]