PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.001G015900.1
Common NamePOPTR_0001s05360g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family EIL
Protein Properties Length: 597aa    MW: 67080.7 Da    PI: 5.4364
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.001G015900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3440.41.6e-134383741323
                         XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
                EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsL 91 
                         e+l++rmwkd+++lkrlke++k    +++ a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++
  Potri.001G015900.1  38 EDLERRMWKDRIKLKRLKEKQKLA--AQQ-AAEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNI 125
                         89****************999963..355.599********************************************************** PP

                         XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHH CS
                EIN3  92 raWWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwg 182
                         raWWkekv+fd+ngpaai+ky+a++l++++++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekgv+pPWWPtG+e+ww 
  Potri.001G015900.1 126 RAWWKEKVRFDKNGPAAIAKYEAECLAMGEAENS--KNGNSQSALQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGVPPPWWPTGNEDWWV 214
                         *****************************99888..7899*************************************************** PP

                         HHT--TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX........ CS
                EIN3 183 elglskdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss........ 265
                         +lgls+ q+ ppykkphdlkk+wkv+vLtavikhmsp+i +ir+++rqsk+lqdkm+akes+++l vl+qee+++++ s+++         
  Potri.001G015900.1 215 KLGLSQGQS-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIPKIRRHVRQSKCLQDKMTAKESAIWLGVLSQEESLIRQPSSDNGtsgvtetp 304
                         ********9.9**********************************************************************4444676655 PP

                         .XXXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.....................XXXXXXXXXXXXXXXXXXXXX CS
                EIN3 266 .slrkqspkvtlsceqkedvegkkeskikhvqavktta.....................gfpvvrkrkkkpsesakvssk 323
                            + q++k  +s+++++dv+g ++   + ++++++++                     +           ++++   ++
  Potri.001G015900.1 305 qGGHGQKKKRAISSDSDYDVDGADDGVGSVSSKDNRRNqsmdveplnsrddatnpvqdkE----------LGKKQPRRKR 374
                         433349999************888888888888888877888888888866644443220..........2222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.7E-12738285No hitNo description
Gene3DG3DSA:1.10.3180.107.7E-72159293IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.35E-62166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009873Biological Processethylene-activated signaling pathway
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 597 aa     Download sequence    Send to blast
MGELEEIGAD ICADLEADDI RCDTIAEKDV TDEEIEAEDL ERRMWKDRIK LKRLKEKQKL  60
AAQQAAEKQK PKQTSDQARR KKMSRAQDGI LKYMLKLMEV CKARGFVYGI IPEKGKPVSG  120
ASDNIRAWWK EKVRFDKNGP AAIAKYEAEC LAMGEAENSK NGNSQSALQD LQDATLGSLL  180
SSLMQHCDPP QRKYPLEKGV PPPWWPTGNE DWWVKLGLSQ GQSPPYKKPH DLKKMWKVGV  240
LTAVIKHMSP DIPKIRRHVR QSKCLQDKMT AKESAIWLGV LSQEESLIRQ PSSDNGTSGV  300
TETPQGGHGQ KKKRAISSDS DYDVDGADDG VGSVSSKDNR RNQSMDVEPL NSRDDATNPV  360
QDKELGKKQP RRKRPRVRSS HADQHPQPQL NDDHLGVERT STLPDINHTD LQPVDYQMHD  420
TQHENFTSST VRPLENGFVG ESNLPQSDFN YYAGVPSANV NSTEKIFADK GPDFYPLGQN  480
SVLHHETTYS NFYNPSLDYG TNHDRQPSQM TMSIRQEDDR FHIPAPQGNG NDLTGGEPHH  540
LIKDTFPTEQ DGAVDRQFEF DLPDFAINSP FLEMSSFSLD DLFVDPEDEL IQCFGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A1e-751652969140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.001G015900.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2142770.0AC214277.1 Populus trichocarpa clone ACSB1145-L17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002299248.20.0ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLB9GMA10.0B9GMA1_POPTR; Uncharacterized protein
STRINGPOPTR_0001s05360.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Representative plantOGRP5631682
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-170ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]