PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta013132
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family BBR-BPC
Protein Properties Length: 98aa    MW: 11100 Da    PI: 4.8337
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pta#S15780509PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind47.28.5e-1520921789
  GAGA_bind 17 aaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllven 89
               ++ lk+   l+l+s  +erda irer+ a++ekk a+ae+  a++qrd+a+a+r++a++erd +++al+ +++
  Pta013132 20 EKCLKDYAMLRLISAKTERDAVIRERDKAIAEKKIALAEKXAAYAQRDAAFAQRDEAIMERDAAFAALENAKD 92
               367999999**********************************************************998765 PP

Sequence ? help Back to Top
Protein Sequence    Length: 98 aa     Download sequence    Send to blast
MDDEDRKGVH PALNDEPLDE KCLKDYAMLR LISAKTERDA VIRERDKAIA EKKIALAEKX  60
AAYAQRDAAF AQRDEAIMER DAAFAALENA KDERNRGX
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.81731e-165xylem
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds to GA-rich elements (GAGA-repeats) present in regulatory sequences of genes involved in developmental processes. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020522700.14e-20barley B recombinant-like protein D isoform X1
SwissprotQ5VSA81e-15BBRD_ORYSJ; Barley B recombinant-like protein D
TrEMBLA0A2D1VJG09e-59A0A2D1VJG0_PINSY; Uncharacterized protein (Fragment)
TrEMBLA0A2D1VJJ09e-59A0A2D1VJJ0_PINPS; Uncharacterized protein (Fragment)
TrEMBLK7P2W79e-59K7P2W7_PINMU; Uncharacterized protein (Fragment)
STRINGERN057773e-19(Amborella trichopoda)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]