PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta013062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 107aa    MW: 11707.4 Da    PI: 9.3155
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Pta#S26634883PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260114.56.9e-361898181
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81
               +CaaCk+lrr+Ca++C++apyf   +p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA+ar+rdPvyG++g   
  Pta013062 18 PCAACKLLRRRCAQECPFAPYFSPLEPQKFASVHKVFGASNVSKMLMEVPENQRADAANSLVYEANARLRDPVYGSTGPSI 98
               7***************************************************************************99655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.41317107IPR004883Lateral organ boundaries, LOB
PfamPF031955.2E-361899IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 107 aa     Download sequence    Send to blast
MTHRPTVGSP AALNTITPCA ACKLLRRRCA QECPFAPYFS PLEPQKFASV HKVFGASNVS  60
KMLMEVPENQ RADAANSLVY EANARLRDPV YGSTGPSIHY TSAQVLR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.153720.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006376019.18e-55hypothetical protein POPTR_0013s08040g
RefseqXP_011014548.18e-55PREDICTED: LOB domain-containing protein 15-like
RefseqXP_011010866.18e-55PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T55e-55LBD15_ARATH; LOB domain-containing protein 15
TrEMBLU5FV559e-55U5FV55_POPTR; Uncharacterized protein
STRINGPOPTR_0013s08040.13e-54(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-56LOB domain-containing protein 15