PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta012241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 162aa    MW: 17418.3 Da    PI: 5.1426
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-56585PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26049.81e-1535153101
     DUF260  53 eredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
                er +a+ ++ yeA+ar++dPvyG+v++i++lqqq+++l+aela ++++l
  Pta012241   3 ERCEAVVTISYEAQARLQDPVYGCVAHIFALQQQVASLQAELAIVQAQL 51 
                6899****************************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.344151IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-13348IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 162 aa     Download sequence    Send to blast
MPERCEAVVT ISYEAQARLQ DPVYGCVAHI FALQQQVASL QAELAIVQAQ LASRMASGSA  60
STSANYPTIS SSSYSEHPHQ FPAHLSLPCQ PAPQPYYALL SRAKKENSSG FASDMDYEFS  120
GSPSDNSSPQ MEVLQRCRNV EENGGGDGGE LQALAHALLR RG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.151090.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD5A9D31e-78D5A9D3_PICSI; Putative uncharacterized protein
STRINGPP1S157_25V6.15e-24(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58190.12e-24lateral organ boundaries-domain 29