PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta012018
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 172aa    MW: 18887.3 Da    PI: 8.7162
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-16032PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.3e-42181171100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq ++l++el+++++e
  Pta012018  18 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLLEVPESQRADAANSLVYEANVRLRDPVYGCMGAISSLQQQAQSLQSELNSVRAE 117
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.41617118IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-4218115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGRRQILGPP GTLNTITPCA ACKLLRRRCA QECPFSPYFS PHEPQKFASV HKVFGASNVS  60
KMLLEVPESQ RADAANSLVY EANVRLRDPV YGCMGAISSL QQQAQSLQSE LNSVRAEIMR  120
YKFRSDAAAM HHQPPGQSSH QASMMPPSSA VYSQGSASTD YTAMNDHSNY YG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448054.15e-84PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T56e-72LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A0D2QQ345e-84A0A0D2QQ34_G
STRINGVIT_13s0067g02380.t018e-83(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.13e-69LOB domain-containing protein 15