PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta011439
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 195aa    MW: 22439.4 Da    PI: 8.8496
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-31801PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.91.1e-5461331128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                lppG  FhPtdeelv +yLkkkv+g+k+e  ++i+evd+yk+ePwdLp k ++++++ +w+fFs+rd+ky++g+r+nrat++gyWkatgkd++v+s +++
  Pta011439   6 LPPGSGFHPTDEELVADYLKKKVHGHKIER-DIIPEVDLYKCEPWDLPdKiCLQSKNLQWHFFSPRDRKYPNGSRTNRATEAGYWKATGKDRKVTS-QQS 103
                79**************************99.99***************5346666666**************************************.899 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                ++g+kktLvfy+grap ge+tdWvmhey+l
  Pta011439 104 TIGTKKTLVFYRGRAPLGERTDWVMHEYHL 133
                9****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-603155IPR003441NAC domain
PROSITE profilePS5100557.16155IPR003441NAC domain
PfamPF023651.5E-277133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MAQISLPPGS GFHPTDEELV ADYLKKKVHG HKIERDIIPE VDLYKCEPWD LPDKICLQSK  60
NLQWHFFSPR DRKYPNGSRT NRATEAGYWK ATGKDRKVTS QQSTIGTKKT LVFYRGRAPL  120
GERTDWVMHE YHLDEKECQA AGLQDSFVLC RVVKKNGLGT KSDDQSVAPT EKMIQMVQIT  180
THYLAIWLNI QYPVX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-54116112171NO APICAL MERISTEM PROTEIN
1ut4_B3e-54116112171NO APICAL MERISTEM PROTEIN
1ut7_A3e-54116112171NO APICAL MERISTEM PROTEIN
1ut7_B3e-54116112171NO APICAL MERISTEM PROTEIN
3swm_A3e-54116115174NAC domain-containing protein 19
3swm_B3e-54116115174NAC domain-containing protein 19
3swm_C3e-54116115174NAC domain-containing protein 19
3swm_D3e-54116115174NAC domain-containing protein 19
3swp_A3e-54116115174NAC domain-containing protein 19
3swp_B3e-54116115174NAC domain-containing protein 19
3swp_C3e-54116115174NAC domain-containing protein 19
3swp_D3e-54116115174NAC domain-containing protein 19
4dul_A3e-54116112171NAC domain-containing protein 19
4dul_B3e-54116112171NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010270697.11e-84PREDICTED: NAC domain-containing protein 45
RefseqXP_029124457.17e-86NAC domain-containing protein 86-like
SwissprotQ9FFI53e-77NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0C9QTT73e-92A0A0C9QTT7_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_10143_3084 transcribed RNA sequence
STRINGXP_010270697.14e-84(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.13e-83NAC domain containing protein 28
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]