PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta010057
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 244aa    MW: 27681.9 Da    PI: 8.8131
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-74027PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.64e-56241521129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kgel 99 
                lppGfrFhPtdeelv++yL+kk+ +++++  ++i+e+d++k+ePwdLp k+k +ekewyfFs rd+ky+t  r+nrat++gyWk+tgkd+e++++ +++l
  Pta010057  24 LPPGFRFHPTDEELVTYYLTKKILDSTFSG-RAIAEADLNKCEPWDLPGKAKMGEKEWYFFSLRDRKYPTRLRTNRATEAGYWKTTGKDREIFNSrSSAL 122
                79**************************99.89***************99999****************************************9856778 PP

        NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                vg+kktLvfykgrapkgekt+Wvmheyrle
  Pta010057 123 VGMKKTLVFYKGRAPKGEKTNWVMHEYRLE 152
                ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.35E-6420176IPR003441NAC domain
PROSITE profilePS5100560.52124176IPR003441NAC domain
PfamPF023652.3E-2925151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MESTLNPMNN AREAEDEAEE NSQLPPGFRF HPTDEELVTY YLTKKILDST FSGRAIAEAD  60
LNKCEPWDLP GKAKMGEKEW YFFSLRDRKY PTRLRTNRAT EAGYWKTTGK DREIFNSRSS  120
ALVGMKKTLV FYKGRAPKGE KTNWVMHEYR LEGKFSYHRL PKNCKDEWVV CRIFQKSAGG  180
KKTSIGLLSR NSYLELPGSP SLPSLLESPY NTAALNDQET GSIESESGTN SAKAHVSCFS  240
TAMX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-542418220174NAC domain-containing protein 19
3swm_B4e-542418220174NAC domain-containing protein 19
3swm_C4e-542418220174NAC domain-containing protein 19
3swm_D4e-542418220174NAC domain-containing protein 19
3swp_A4e-542418220174NAC domain-containing protein 19
3swp_B4e-542418220174NAC domain-containing protein 19
3swp_C4e-542418220174NAC domain-containing protein 19
3swp_D4e-542418220174NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.170811e-177root
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001292765.11e-105uncharacterized protein LOC18434770
RefseqXP_020523105.11e-105uncharacterized protein LOC18434770 isoform X1
RefseqXP_020523106.11e-105uncharacterized protein LOC18434770 isoform X1
SwissprotQ9FLJ21e-98NC100_ARATH; NAC domain-containing protein 100
TrEMBLG0LD341e-147G0LD34_GINBI; NACa protein (Fragment)
STRINGERN065711e-105(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.13e-96NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]