PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta009772
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 253aa    MW: 27859.7 Da    PI: 8.3624
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-120782553PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26049.41.3e-1526922389
     DUF260 23 paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89
               +++q++++ +++k++G++ +++l+++ p++ r+++++sl+yeA+ r+ +Pv+G++g++ ++++ ++ 
  Pta009772 26 AESQANATIFLAKFYGRAGLMNLISNGPDNLRPAIFRSLLYEACGRVVNPVSGSIGLLCSGNWAVRL 92
               4678999********************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.3441104IPR004883Lateral organ boundaries, LOB
PfamPF031958.2E-122792IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MAAECSERDA PNHAFSGRAS SGXRTAESQA NATIFLAKFY GRAGLMNLIS NGPDNLRPAI  60
FRSLLYEACG RVVNPVSGSI GLLCSGNWAV RLQAGVESIL RGNWKPQTPV ETMAARKLQK  120
SVKTRQRSKG FSHSKSKRNE GERGPVSDHV ESSSKSDYCG DVANVSQKTS GNGDFDERYV  180
DKYSMFSTAR EQEEFACVDQ AQMQYCHDLS NPKTSETETS FNAVELELTL GSKVSFRRTP  240
DKISSSEWWP SSQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.127610.0root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263769.12e-41PREDICTED: LOB domain-containing protein 41-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67100.16e-40LOB domain-containing protein 40