PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta009482
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 263aa    MW: 28887.3 Da    PI: 6.3074
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-8849PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.25.7e-48151442128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....kg 97 
                 +GfrFhPtdeel+++yL+kkv++++l++  +i+++d y+++PwdLp+k+  +e+ewyfFs+rd++y++g r+nra+ sgyWkatg+d +++s     + 
  Pta009482  15 LVGFRFHPTDEELITHYLEKKVSSSPLPA-PIIADIDPYQHDPWDLPAKAFFGENEWYFFSRRDHEYPSGARPNRAAGSGYWKATGSDIPIVSMsgssSP 113
                68**************************9.88***************8777899**************************************99655555 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                ++vg+kk+Lvfykg+  +g+ t+W+mhey l
  Pta009482 114 RKVGVKKSLVFYKGKPAEGVMTNWIMHEYYL 144
                56***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-5810168IPR003441NAC domain
PROSITE profilePS5100555.2114169IPR003441NAC domain
PfamPF023656.9E-2616143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MEGVAFQQQA VPELLVGFRF HPTDEELITH YLEKKVSSSP LPAPIIADID PYQHDPWDLP  60
AKAFFGENEW YFFSRRDHEY PSGARPNRAA GSGYWKATGS DIPIVSMSGS SSPRKVGVKK  120
SLVFYKGKPA EGVMTNWIMH EYYLAETLPT QKNGSAPLDD WVLCRLFQRL NHSPGMLSCS  180
QLEVPSPSAT DVQRSRQKPA IPKLGSFSRV PLNEGPSVEN LPSHATSDAN NAAVSSAEST  240
SSPQVVPHPL NSSESGSDSS MNW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-611716920165NO APICAL MERISTEM PROTEIN
1ut4_B1e-611716920165NO APICAL MERISTEM PROTEIN
1ut7_A1e-611716920165NO APICAL MERISTEM PROTEIN
1ut7_B1e-611716920165NO APICAL MERISTEM PROTEIN
3swm_A1e-611716923168NAC domain-containing protein 19
3swm_B1e-611716923168NAC domain-containing protein 19
3swm_C1e-611716923168NAC domain-containing protein 19
3swm_D1e-611716923168NAC domain-containing protein 19
3swp_A1e-611716923168NAC domain-containing protein 19
3swp_B1e-611716923168NAC domain-containing protein 19
3swp_C1e-611716923168NAC domain-containing protein 19
3swp_D1e-611716923168NAC domain-containing protein 19
4dul_A1e-611716920165NAC domain-containing protein 19
4dul_B1e-611716920165NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.12960.0cone| embryo| root| xylem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}.
UniprotTISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019453752.12e-72PREDICTED: NAC transcription factor 56-like
SwissprotQ8H4S41e-68NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLD5ABS01e-115D5ABS0_PICSI; Uncharacterized protein
STRINGXP_004293567.17e-70(Fragaria vesca)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]