PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta008343
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family Trihelix
Protein Properties Length: 302aa    MW: 35751.9 Da    PI: 8.4637
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-55083PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.59.7e-2549130186
   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                +W   e+++ i++r e+e+++ ++k++k+lWe +s++m+e+gf+rs++qCk+kw+nl +ryk  ++++ ++     ++cp+fd+l+
  Pta008343  49 QWGFTETKEFIAIRAELEKDFTQTKRNKTLWELISSRMKEKGFRRSSEQCKCKWKNLVNRYKGKETSDPEN----GRQCPFFDELH 130
                6999***********************************************************99999974....678******98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.85342106IPR017877Myb-like domain
CDDcd122032.16E-2648113No hitNo description
PfamPF138371.9E-2249132No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MAALPLQLTP TVAISSGDHL GGPNSSNVVT NNGGGGLGSS LKKDDRIPQW GFTETKEFIA  60
IRAELEKDFT QTKRNKTLWE LISSRMKEKG FRRSSEQCKC KWKNLVNRYK GKETSDPENG  120
RQCPFFDELH AIFTERANTM QRLMLESEGG NNQPKKKLKR LKGLQGEKSS DEYSDDEEDE  180
EEDSEDERIV RNKKRKADRE RQRVTAEKSR ANSMQEVLQD FFQQQQRIEI QWREYIERRE  240
QERRLVEQDW RQAVDKLERE RIHMEQAWRE REEQRRAREE GRAEKRDALL HTLLNRLIRE  300
DL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.342020.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006854232.11e-105PREDICTED: trihelix transcription factor GT-3b isoform X2
TrEMBLA0A0D6R6H21e-142A0A0D6R6H2_ARACU; Uncharacterized protein
STRINGPP1S285_47V6.14e-99(Physcomitrella patens)