PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta007891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 325aa    MW: 37117.8 Da    PI: 7.2647
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-35422PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.71.6e-51141441128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....k 96 
                lppGfrFhPtdeel+ +yLk++v+ ++l++ ++i+e+d+yk++PwdLp+k+  +e+ewyfFs+rd+ky++g+r+nr++ksgyWkatg++k++++     +
  Pta007891  14 LPPGFRFHPTDEELLIHYLKNRVSCSPLPA-SIIAEIDLYKHDPWDLPEKACFGEQEWYFFSPRDRKYPNGSRPNRSAKSGYWKATGTEKPIFVMsesmS 112
                79****************************.89***************8777899*************************************99877888 PP

        NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                +++vg+kk+Lvf+kgr pkg kt+W+mheyrl
  Pta007891 113 SQKVGVKKSLVFFKGRPPKGLKTNWIMHEYRL 144
                888***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.15E-629169IPR003441NAC domain
PROSITE profilePS5100559.89114169IPR003441NAC domain
PfamPF023651.7E-2615144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
XEGAEFHHQV LPQLPPGFRF HPTDEELLIH YLKNRVSCSP LPASIIAEID LYKHDPWDLP  60
EKACFGEQEW YFFSPRDRKY PNGSRPNRSA KSGYWKATGT EKPIFVMSES MSSQKVGVKK  120
SLVFFKGRPP KGLKTNWIMH EYRLIETMPT KKLRSLRLDD WVLCRIYKKA RHSTPVVSNP  180
ELQSPSPADV QQESVMPKFS SVSGQLQSED PFMQSFLSHD VLDANNAAMS YVEPSSSLQV  240
VPQQLNSSGT RSQVSISVGF NCDEVSSVYP AKRQNCLNPS PSLEFEGWNT YMDMPVPDQH  300
RYQLPISENW NPEPIPWPLP TGNVW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-711416917165NO APICAL MERISTEM PROTEIN
1ut4_B1e-711416917165NO APICAL MERISTEM PROTEIN
1ut7_A1e-711416917165NO APICAL MERISTEM PROTEIN
1ut7_B1e-711416917165NO APICAL MERISTEM PROTEIN
3swm_A1e-711416920168NAC domain-containing protein 19
3swm_B1e-711416920168NAC domain-containing protein 19
3swm_C1e-711416920168NAC domain-containing protein 19
3swm_D1e-711416920168NAC domain-containing protein 19
3swp_A1e-711416920168NAC domain-containing protein 19
3swp_B1e-711416920168NAC domain-containing protein 19
3swp_C1e-711416920168NAC domain-containing protein 19
3swp_D1e-711416920168NAC domain-containing protein 19
4dul_A1e-711416917165NAC domain-containing protein 19
4dul_B1e-711416917165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Sequences of the 11 European varieties of H.vulgare tested belongs to the same haplotype while the sequence found in H.spontaneum, an ancestor of the cultivated H.vulgare which has a higher GPC, belongs to an other haplotype. {ECO:0000269|PubMed:20005003}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012440667.11e-88PREDICTED: NAC transcription factor 25
RefseqXP_017610410.11e-88PREDICTED: NAC transcription factor 25-like
SwissprotD2SMN41e-82NAMB1_HORVS; NAC transcription factor NAM-B1
TrEMBLD5ABS01e-117D5ABS0_PICSI; Uncharacterized protein
STRINGGorai.009G170700.15e-88(Gossypium raimondii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-82NAC domain containing protein 25
Publications ? help Back to Top
  1. Jamar C, et al.
    NAM-1gene polymorphism and grain protein content in Hordeum.
    J. Plant Physiol., 2010. 167(6): p. 497-501
    [PMID:20005003]