PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta007838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family GATA
Protein Properties Length: 328aa    MW: 35889.7 Da    PI: 4.8364
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-51382547PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.12.5e-18228262135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                Cs+C + kTp+WR gp g+ktLCnaCG+++++ +l
  Pta007838 228 CSHCLVQKTPQWRAGPLGPKTLCNACGVRFKSGRL 262
                *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169922.2E-8112316IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.121222258IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-15222272IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.18E-14223285No hitNo description
Gene3DG3DSA:3.30.50.108.2E-14226260IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.17E-13227284No hitNo description
PfamPF003203.9E-16228262IPR000679Zinc finger, GATA-type
PROSITE patternPS003440228253IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MDFQTAPLYC PDSSEAWGAV GEAFHIDDLL DFSNDDIGAP IQNDEENSSE STEVSAGSAE  60
ANYSSVTQLT EELPAAELCV PMDTLADLEW LSTFVEDSFM PELPSACGPT SEQVPLTDGN  120
KTASDDNDEP KPRSCQASFL AACKKWIPVK ARSKRSRTGG RVWSFNGGRV WSFNGPLLPP  180
NPSFESGGVV FTQSSDSSCS ESSQPRPAKK YKKTHSKKAQ DGSQPRRCSH CLVQKTPQWR  240
AGPLGPKTLC NACGVRFKSG RLVPEYRPAI SPTFLSEVHS NSHRKILEMR RQKEEEQQRP  300
ELTSQTCSSG ANESFSDNSL PSEESLLV
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.138350.0root| shoot| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D6QSG12e-88A0A0D6QSG1_ARACU; GATA transcription factor
STRINGPP1S241_14V6.18e-61(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-46GATA transcription factor 7