PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta007544
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 348aa    MW: 39201.2 Da    PI: 7.1514
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-21725PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM157.26.7e-49121421128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....k 96 
                lppGfrF Pt+eel+v+yL++k++  +l++  +i++vd+yk++Pw+Lp+k+  +ekewyfF++r++ky++g+r+nra+ sgyWkatg d ++ s+     
  Pta007544  12 LPPGFRFFPTEEELIVHYLCRKAALLPLHV-PIIADVDLYKYDPWQLPEKALFGEKEWYFFTPRNRKYPNGSRPNRAAGSGYWKATGADMPISSTasrgV 110
                79**************************99.88***************8888899**************************************9877665 PP

        NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                ++ vg+kk Lvfy g+ap+g+kt+W+mheyrl
  Pta007544 111 KKRVGVKKALVFYVGKAPSGSKTNWLMHEYRL 142
                666***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.41E-6010168IPR003441NAC domain
PROSITE profilePS5100557.80212168IPR003441NAC domain
PfamPF023651.6E-2413142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MGRRDAEADL QLPPGFRFFP TEEELIVHYL CRKAALLPLH VPIIADVDLY KYDPWQLPEK  60
ALFGEKEWYF FTPRNRKYPN GSRPNRAAGS GYWKATGADM PISSTASRGV KKRVGVKKAL  120
VFYVGKAPSG SKTNWLMHEY RLADINRPAR KKDSLRLDDW VLCRIYNRKI GAEKLALEPK  180
ESFNDVPMET IDEKEMKDQP TSTSINHSAI EQSNPSFDHL SKLGSSPTCY NVVPPGASPM  240
NCNISVQNLD FLQNSTTPFS GSALRAPAKN TAFNPISPSQ TICNSTELIS GLHDDFSCSK  300
ASSFSEPIWV KEEVESSFRL ENISQEQQQS LFNFDPEGLQ SSFPHLDW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-79517410171NO APICAL MERISTEM PROTEIN
1ut4_B9e-79517410171NO APICAL MERISTEM PROTEIN
1ut7_A9e-79517410171NO APICAL MERISTEM PROTEIN
1ut7_B9e-79517410171NO APICAL MERISTEM PROTEIN
3swm_A1e-78517413174NAC domain-containing protein 19
3swm_B1e-78517413174NAC domain-containing protein 19
3swm_C1e-78517413174NAC domain-containing protein 19
3swm_D1e-78517413174NAC domain-containing protein 19
3swp_A1e-78517413174NAC domain-containing protein 19
3swp_B1e-78517413174NAC domain-containing protein 19
3swp_C1e-78517413174NAC domain-containing protein 19
3swp_D1e-78517413174NAC domain-containing protein 19
4dul_A9e-79517410171NAC domain-containing protein 19
4dul_B9e-79517410171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.193650.0root| shoot
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in stems, leaf blades and callus. Weakly expressed in developing flowers. {ECO:0000269|PubMed:10660065}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:20632034}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020673301.12e-94NAC domain-containing protein 68
SwissprotQ52QH46e-90NAC68_ORYSJ; NAC domain-containing protein 68
TrEMBLA0A0D6R3P91e-139A0A0D6R3P9_ARACU; Uncharacterized protein
STRINGXP_008782755.16e-92(Phoenix dactylifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.13e-83NAC family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Taga Y, et al.
    Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4.
    Plant Signal Behav, 2009. 4(8): p. 740-2
    [PMID:19820348]
  3. Xia N, et al.
    Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses.
    Mol. Biol. Rep., 2010. 37(8): p. 3703-12
    [PMID:20213512]
  4. Takasaki H, et al.
    The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice.
    Mol. Genet. Genomics, 2010. 284(3): p. 173-83
    [PMID:20632034]
  5. Nakayama A, et al.
    Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice.
    BMC Plant Biol., 2013. 13: p. 150
    [PMID:24093634]
  6. Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS
    IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice.
    Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60
    [PMID:26766411]