PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta007235
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 374aa    MW: 42702.6 Da    PI: 4.3641
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-21257PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM175.12.1e-54221512129
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                ppGfrF+P+dee+v +yLk+kv+g+k+e+ +vi+e+d+yk+ePwdLp k  + +++ ewyfF++rd+ky++g+r+nrat++gyWkatgkd++v s+ ++ 
  Pta007235  22 PPGFRFRPSDEEIVGYYLKNKVHGNKFEF-DVIREIDLYKCEPWDLPeKsILPSRDLEWYFFCPRDRKYPNGSRSNRATEAGYWKATGKDRKVSSRsNNY 120
                9**************************99.9***************95434455777*************************************987777 PP

        NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                ++g+kktLvfykgrap+ge+tdW+mheyrle
  Pta007235 121 KIGTKKTLVFYKGRAPNGERTDWLMHEYRLE 151
                8****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-639173IPR003441NAC domain
PROSITE profilePS5100559.08121173IPR003441NAC domain
PfamPF023659.4E-2922150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
ARVGFDEKWM ASSVQAAAVN FPPGFRFRPS DEEIVGYYLK NKVHGNKFEF DVIREIDLYK  60
CEPWDLPEKS ILPSRDLEWY FFCPRDRKYP NGSRSNRATE AGYWKATGKD RKVSSRSNNY  120
KIGTKKTLVF YKGRAPNGER TDWLMHEYRL EGTQCKGGTN LQDLYVLSRV FRKPRQGSND  180
QETFQEPFPI INKTSSPTDG SDGDIEGQSE DASPGKPEDD APASSRSETS SEILDNKIED  240
NCIDGPMECP EDISNPNCNS VSHRDTSTKE NDDSQRRNQQ LQNDPFYSPY DYEFPLIFNN  300
PYSDYSLGTQ VNFSVMEPEA FERDFDFGSV SDQDNIDLAS MLNSIDXEDL YPLLPIIEEE  360
KXDXPCVAGX XTSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-501917315165NO APICAL MERISTEM PROTEIN
1ut4_B4e-501917315165NO APICAL MERISTEM PROTEIN
1ut7_A4e-501917315165NO APICAL MERISTEM PROTEIN
1ut7_B4e-501917315165NO APICAL MERISTEM PROTEIN
3swm_A4e-501917318168NAC domain-containing protein 19
3swm_B4e-501917318168NAC domain-containing protein 19
3swm_C4e-501917318168NAC domain-containing protein 19
3swm_D4e-501917318168NAC domain-containing protein 19
3swp_A4e-501917318168NAC domain-containing protein 19
3swp_B4e-501917318168NAC domain-containing protein 19
3swp_C4e-501917318168NAC domain-containing protein 19
3swp_D4e-501917318168NAC domain-containing protein 19
3ulx_A4e-501715011140Stress-induced transcription factor NAC1
4dul_A4e-501917315165NAC domain-containing protein 19
4dul_B4e-501917315165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0C9S8642e-97A0A0C9S864_9SPER; TSA: Wollemia nobilis Ref_Wollemi_Transcript_5693_2745 transcribed RNA sequence
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.12e-77NAC domain containing protein 28