PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta007013
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family GATA
Protein Properties Length: 395aa    MW: 43287.6 Da    PI: 5.8446
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-1670PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA60.52.1e-19275309135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                Cs+C t kTp+WR gp+g+ktLCnaCG+++++ +l
  Pta007013 275 CSHCATQKTPQWRAGPEGPKTLCNACGVRFKSGRL 309
                *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004018.3E-18269319IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.925269305IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.0E-15273307IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577161.19E-13273332No hitNo description
CDDcd002029.08E-15274321No hitNo description
PROSITE patternPS003440275300IPR000679Zinc finger, GATA-type
PfamPF003203.0E-17275309IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
XDDLLDFSNE EISAPIGEKC SDANGADSST IKETAHMAGT MLICNNDSLL DKRSSSQISI  60
AVSTDIKGHN SPGDICVSVS HDASSSTAFD GLLPFLLFSX SMSNPKVKKS NNNLTPSVCL  120
FPSLQRVEDE FLIKLISIVV LQCDDLAELE WLSNFVEDSF STGNVPTEIT HHVLDSDKGS  180
SSCTLEIWPV PSRARSKRSR TPVCNWVSRV LNSPSSSASI VYQNGSTSES SEQADGEESL  240
STNRDKLSKT ETSHVTSNKK GVVQVDHHGT QVRKCSHCAT QKTPQWRAGP EGPKTLCNAC  300
GVRFKSGRLL PEYRPAASPT FVGTQHSNSH RKVIEMRREK LNDMDEKPHG HIEKLVQGLI  360
EYNHSSSVQQ SDFVKSDDDE CLLHNNINPG DMDFL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.346230.0shoot| xylem
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-50GATA transcription factor 12