PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta005979
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 139aa    MW: 15568 Da    PI: 8.2223
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-29025PU_refplantGDBView CDS
gnl|UG|Pta#S25090886PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.34e-4191045100
     DUF260   5 CkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                 k+lrr+CakdC++apyfp+++p+kfa vh++FGasnv k+l++lpee+r da+ss+vyeA+ar+rdP+yG+vg i++lqqq++ lk++lal+++e
  Pta005979   9 VKLLRRRCAKDCIFAPYFPSDDPHKFASVHRVFGASNVNKMLQDLPEEQRGDAVSSMVYEANARVRDPIYGCVGAISSLQQQVAYLKSQLALAQAE 104
                589*****************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.8584105IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-409102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MACHRALLVK LLRRRCAKDC IFAPYFPSDD PHKFASVHRV FGASNVNKML QDLPEEQRGD  60
AVSSMVYEAN ARVRDPIYGC VGAISSLQQQ VAYLKSQLAL AQAEIVHLKM RQTPLSLFNT  120
NDCKMMIMDE GSSPSHILD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.69620.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607861.13e-64LOB domain protein
SwissprotQ8LBW38e-55LBD12_ARATH; LOB domain-containing protein 12
TrEMBLG7JIR83e-64G7JIR8_MEDTR; LOB domain protein
STRINGSolyc11g045530.1.16e-63(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.15e-56LBD family protein