PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta005336
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 188aa    MW: 21073.4 Da    PI: 5.23
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-24175PU_refplantGDBView CDS
gnl|UG|Pta#S20504907PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.33.4e-40381371100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck++r+kC+++Cvlapyfp+++p+kf  vh++FG+ +v+kll++lp e+r da++s+vyeA  r +dPv+G++gvi+ l++++++l+++la++++e
  Pta005336  38 PCAGCKIQRKKCSHNCVLAPYFPQDNPQKFLLVHRVFGNGHVVKLLQDLPAEQRGDAVNSMVYEASQRFQDPVHGCAGVIKYLKNKVSELQSQLASTQRE 137
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.30337138IPR004883Lateral organ boundaries, LOB
PfamPF031957.7E-3938135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
XCIPSFSFEN TLLAHSNEEM SDISAKSEPD QTWPSTSPCA GCKIQRKKCS HNCVLAPYFP  60
QDNPQKFLLV HRVFGNGHVV KLLQDLPAEQ RGDAVNSMVY EASQRFQDPV HGCAGVIKYL  120
KNKVSELQSQ LASTQRELAN MSMQHAKLLS FLNEGSDSHF YNGLLLESDD THALEDGDAM  180
ELWEPLWT
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.182480.0needle
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002889671.14e-52LOB domain protein 1
SwissprotQ9LQR07e-53LBD1_ARATH; LOB domain-containing protein 1
TrEMBLB8LQI93e-95B8LQI9_PICSI; Putative uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_10006231e-51(Arabidopsis lyrata)