PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta004969
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 211aa    MW: 23124.2 Da    PI: 9.5496
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-7277PU_refplantGDBView CDS
gnl|UG|Pta#S26635289PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.81.6e-42421411100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe +r da++slvyeA+ar+rdPvyG++gvi++lqqq ++l+ael+++++e
  Pta004969  42 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGASNVSKMLLEVPEGQRADAANSLVYEANARIRDPVYGCMGVISTLQQQAQSLQAELNAVRSE 141
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.64341142IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4242139IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 211 aa     Download sequence    Send to blast
MSKEREKGEG LNSVNRKLKR SESERVRRTM MGAQSSSNTS TPCAACKLLR RRCAQECPFS  60
PYFSPHEPQK FASVHKVFGA SNVSKMLLEV PEGQRADAAN SLVYEANARI RDPVYGCMGV  120
ISTLQQQAQS LQAELNAVRS EIMRYRCHEN AMAAAMAVGY PSMQVSDRGA ASSAISSQTS  180
DSADFAAVSP RPPMATSDTK VTVRPWHSHL H
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.186720.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007011230.17e-77LOB domain-containing protein 15
SwissprotQ8L5T52e-66LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA9P2E33e-84A9P2E3_PICSI; Putative uncharacterized protein
STRINGGLYMA06G15050.16e-75(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-63LOB domain-containing protein 15