PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta004872
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 215aa    MW: 24164.3 Da    PI: 6.4212
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-33392PU_refplantGDBView CDS
gnl|UG|Pta#S25801307PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.13.7e-44111101100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +Ca+Ck+lrr+CakdCv+apyfpa+qp+kfa+vhk+FGasnv+k+l++lp ++r da+ss+vye++ar+rdPvyG+vg i+ lqqq+++l+ +la++++e
  Pta004872  11 PCASCKLLRRRCAKDCVFAPYFPADQPQKFACVHKVFGASNVSKMLQELPVHQRGDAVSSMVYESNARVRDPVYGCVGAISYLQQQVANLQMQLARAQAE 110
                7**********************************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.91710111IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4311108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MGTSKTSGSS PCASCKLLRR RCAKDCVFAP YFPADQPQKF ACVHKVFGAS NVSKMLQELP  60
VHQRGDAVSS MVYESNARVR DPVYGCVGAI SYLQQQVANL QMQLARAQAE IMCMHMQQQE  120
ALLSDNTDNI IDSKQAIMGL LSESTDNIDT KQGIMGRMDD HQFHYDQIHA NNYHHPSDCC  180
TSSHDSSHQL LTHDQTVYDA LDIKEILWTR YSMLE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010099465.18e-69hypothetical protein L484_011165
SwissprotQ8LBW33e-67LBD12_ARATH; LOB domain-containing protein 12
TrEMBLW9RKL89e-69W9RKL8_9R
STRINGVIT_06s0004g07200.t011e-67(Vitis vinifera)