PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta004600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 229aa    MW: 25076.3 Da    PI: 7.031
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-71005PU_refplantGDBView CDS
gnl|UG|Pta#S20496662PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26035.43e-114564395
     DUF260 43 lkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
               ++l+ + pe+ r+++++sl+y A+ r+ dP+ G+vg+++++++ ++q+ +e  
  Pta004600  4 INLICSGPEHLRPAMFRSLLYDACGRMLDPIFGSVGLVRSGNWAVCQAGVESI 56
               6777888999*************************************988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031958.2E-7354IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MALINLICSG PEHLRPAMFR SLLYDACGRM LDPIFGSVGL VRSGNWAVCQ AGVESILRGN  60
SASHVVPMEA MASKLHRVKA KDRFKRVSRA KPKQKLRKSA LINKSHIVST SKSDGWYEVT  120
NSLQGAADNG KSTTELEPNE FFRSDQAEME YGHDLIWNIE TSEAEAEVPY NAVKLELTLG  180
YQGSTSPDRI MLADNLXLQG SPFESVNGEV SAVSKSVFSP ECMGMAAFP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.178530.0root
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67100.15e-25LOB domain-containing protein 40