PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta004433
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family Trihelix
Protein Properties Length: 236aa    MW: 27003.5 Da    PI: 9.3598
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-37948PU_refplantGDBView CDS
gnl|UG|Pta#S26639566PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix83.72.3e-2647129286
   trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                W ++e++aLi++rre++  ++++k++k+lW+++s  mrergf rsp++C++kw+nl k+ykk k++  ++  + s +++ +++le
  Pta004433  47 WGHDEIRALIALRREIDGLFNTSKSNKHLWDKISLIMRERGFDRSPTMCTDKWRNLLKEYKKAKHHHDSH--DGSAKMSCYKDLE 129
                ********************************************************************97..6667899999998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.57339103IPR017877Myb-like domain
SMARTSM007170.001543105IPR001005SANT/Myb domain
SuperFamilySSF466897.81E-544142IPR009057Homeodomain-like
PfamPF138376.1E-1946131No hitNo description
CDDcd122036.06E-2747110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MEVVTNGMQL QAQVQQHHHH HHMLLSSDIN GEDHEIKTTP KKRAEVWGHD EIRALIALRR  60
EIDGLFNTSK SNKHLWDKIS LIMRERGFDR SPTMCTDKWR NLLKEYKKAK HHHDSHDGSA  120
KMSCYKDLEE LLRERAKAAP YRSPNKVADL DSYPHFSPKG TGRSPFNMER RLDHERLPLA  180
MPLSDATAAN GTPPWNWRDA AGNGGENHTP YNGKVILVKW GDITRRIGID GTAEAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2jmw_A1e-4041127186DNA binding protein GT-1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.212880.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930053.15e-98PREDICTED: trihelix transcription factor GT-1-like isoform X2
SwissprotQ9FX531e-83TGT1_ARATH; Trihelix transcription factor GT-1
TrEMBLA9NQR41e-153A9NQR4_PICSI; Putative uncharacterized protein
STRINGVIT_01s0010g02420.t015e-87(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13450.12e-84Trihelix family protein