PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002879
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family GATA
Protein Properties Length: 309aa    MW: 34517.7 Da    PI: 6.1096
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-49380PU_refplantGDBView CDS
gnl|UG|Pta#S20928682PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.91.3e-18185219135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C +C ttkTp+WR gp g+ktLCnaCG++y++ +l
  Pta002879 185 CMHCDTTKTPQWRTGPMGPKTLCNACGVRYKSGRL 219
                99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.084179215IPR000679Zinc finger, GATA-type
SMARTSM004011.7E-17179229IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.103.8E-15183217IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.04E-15183242No hitNo description
CDDcd002028.01E-14184231No hitNo description
PfamPF003203.1E-16185219IPR000679Zinc finger, GATA-type
PROSITE patternPS003440185210IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
XSCNSSLDGK SFRAYNVLET DANNNGHLCV PCDDLAELEW LSNFVEDSFS TEQAPKPIFP  60
PNFGDVRTDK EEEKPHIANP IRSTSPLSGL DTSSSSWKTP SFSPETPVPG RARSKRSRAP  120
ACNWSSRIVS PASSASALEN GPTSSVLSSD SEFFAESYFP AKKPAKMSQG NKKREQDQQT  180
QIRKCMHCDT TKTPQWRTGP MGPKTLCNAC GVRYKSGRLV PEYRPAASPT FVVSKHSNSH  240
RKVIEMRRQK EMQDALQQAS KLYPNDKEGN EDGDEYEEDE DGSDGQYPHF GSDDDTYLVH  300
TNQDYRHFI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.60560.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020208394.12e-71GATA transcription factor 12 isoform X2
TrEMBLA0A151QPZ25e-70A0A151QPZ2_CAJCA; GATA transcription factor
STRINGXP_010668515.11e-68(Beta vulgaris)