PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family BBR-BPC
Protein Properties Length: 312aa    MW: 34066.2 Da    PI: 7.007
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-67340PU_refplantGDBView CDS
gnl|UG|Pta#S26641296PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind288.62.7e-8813111300
  GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.salpvg 98 
                m+  +  +   +g ye++  ++++ +l+lm++iaerd +i er++a++ekkaa+aerd+a+lqr+ a+++rn al+erd +++al +  +     + +++
  Pta002840   1 MEGGNALDfGDWGTYEES--MNDHPALKLMAVIAERDVAILERDTAIAEKKAAYAERDVALLQREVAISDRNSALLERDAAAAALGYSGQMNLsGQRSPS 98 
                556666666789999988..*****************************************************************998765443667788 PP

  GAGA_bind  99 vqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkak....kkkkksekskkkvkkesaderskaekksi 194
                +++l g k     q   +p+ e   +e++++ ++  + i+ ++e+ ++k  +    ++ +p  k ++     + + ++     vk+e  d++ k++k + 
  Pta002840  99 CGTLVGIKVQSVGQVFPDPHSESLVAEQPKQTNQADNRIKGERESPSNKVFNG--YEPITPVFKIQQkkxaTTGQDTNGLLAVVKHEMRDQDYKEDKTTF 196
                89888888777777766666666666666666666666665544443333222..222222222222000012222222233444444444444444443 PP

  GAGA_bind 195 d...lvl..ng....vslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpvDL 285
                d   l +  ++    +++D s+lP+PvCsCtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+++++rgaR++grKmS+gaf klL++L a+Gy+l  pvDL
  Pta002840 197 DtsgLPItfDTsalpITFDASALPIPVCSCTGVPQQCYRWGSGGWQSACCTTSISMYPLPMNPNKRGARLGGRKMSGGAFAKLLARLIADGYSLEYPVDL 296
                311143311333344899********************************************************************************** PP

  GAGA_bind 286 kdhWAkHGtnkfvti 300
                k+hWAkHGtn+++ i
  Pta002840 297 KNHWAKHGTNRYIRI 311
                *************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.9E-851312IPR010409GAGA-binding transcriptional activator
PfamPF062179.7E-801312IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MEGGNALDFG DWGTYEESMN DHPALKLMAV IAERDVAILE RDTAIAEKKA AYAERDVALL  60
QREVAISDRN SALLERDAAA AALGYSGQMN LSGQRSPSCG TLVGIKVQSV GQVFPDPHSE  120
SLVAEQPKQT NQADNRIKGE RESPSNKVFN GYEPITPVFK IQQKKXATTG QDTNGLLAVV  180
KHEMRDQDYK EDKTTFDTSG LPITFDTSAL PITFDASALP IPVCSCTGVP QQCYRWGSGG  240
WQSACCTTSI SMYPLPMNPN KRGARLGGRK MSGGAFAKLL ARLIADGYSL EYPVDLKNHW  300
AKHGTNRYIR IQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.219330.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLH1ZN580.0H1ZN58_PINTA; GAGA-binding transcriptional activator
STRINGGLYMA06G02880.33e-76(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.14e-71basic pentacysteine 6