Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002840
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family BBR-BPC
Protein Properties Length: 312aa    MW: 34066.2 Da    PI: 7.007
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-67340PU_refplantGDBView CDS
gnl|UG|Pta#S26641296PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
  GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.salpvg 98 
                m+  +  +   +g ye++  ++++ +l+lm++iaerd +i er++a++ekkaa+aerd+a+lqr+ a+++rn al+erd +++al +  +     + +++
                556666666789999988..*****************************************************************998765443667788 PP

  GAGA_bind  99 vqvlsgtksidslqqlsepqledsavelreeeklealpieeaaeeakekkkkkkrqrakkpkekkak....kkkkksekskkkvkkesaderskaekksi 194
                +++l g k     q   +p+ e   +e++++ ++  + i+ ++e+ ++k  +    ++ +p  k ++     + + ++     vk+e  d++ k++k + 
                89888888777777766666666666666666666666665544443333222..222222222222000012222222233444444444444444443 PP

  GAGA_bind 195 285
                d   l +  ++    +++D s+lP+PvCsCtG+++qCY+WG+GGWqSaCCtt+iS+yPLP+++++rgaR++grKmS+gaf klL++L a+Gy+l  pvDL
                311143311333344899********************************************************************************** PP

  GAGA_bind 286 kdhWAkHGtnkfvti 300
                k+hWAkHGtn+++ i
  Pta002840 297 KNHWAKHGTNRYIRI 311
                *************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012262.9E-851312IPR010409GAGA-binding transcriptional activator
PfamPF062179.7E-801312IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLH1ZN580.0H1ZN58_PINTA; GAGA-binding transcriptional activator
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.14e-71basic pentacysteine 6