PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family BBR-BPC
Protein Properties Length: 313aa    MW: 34812.4 Da    PI: 9.9499
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-49390PU_refplantGDBView CDS
gnl|UG|Pta#S25803320PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind253.51.3e-7713131301
  GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.salpvg 98 
                mdd+g  + r++   e++  +k++ gl+ ms++aerda+i ern+a+sekkaa+ae++ a  qrd a a+rn a++erd +++al +++++    + + +
  Pta002821   1 MDDEGRLDiRHWDTLEQS--VKDHPGLKFMSVLAERDAAILERNTAFSEKKAAFAEKETAIFQRDVAYADRNTAILERDAAAAALNYARDGGWnGQRSLT 98 
                9************98887..******************************************************************99998764667789 PP

  GAGA_bind  99 vqvlsgtksidslqqlse......pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader..... 186
                +++ls++k ++ l +         + +   +++ +   + le+lp eea+++ak+++kkk +++++  k+k   ++ k s  +kk+ k++++ e+     
  Pta002821  99 CGTLSNAKILQVLAENPTfsareyQTM--RPINvAYPASVLETLPFEEAQKTAKRTSKKKDGEKESPSKRKSDGSEPK-SLRQKKQRKPSGTTEEglnge 195
                9*******9998887333344432222..2222245556666677666666666655555444443333333332222.222223333333223367788 PP

  GAGA_bind 187 ...skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpv 283
                   +k+e+k++d+v+ng+ l               l      GnGGWqSaCCtt+iS+yPLP++++rrgaR+agrKmS+gaf+klLe+L aeG++l+ p+
  Pta002821 196 vtvVKKEQKNLDVVINGIXLIFQLCLFLFALALEWLNNVTGGGNGGWQSACCTTSISMYPLPMNPNRRGARVAGRKMSGGAFRKLLERLGAEGFNLNYPI 295
                888****************97776666667777889999999********************************************************** PP

  GAGA_bind 284 DLkdhWAkHGtnkfvtir 301
                DLk++WAkHGtnkfvtir
  Pta002821 296 DLKSYWAKHGTNKFVTIR 313
                *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012265.4E-781313IPR010409GAGA-binding transcriptional activator
PfamPF062171.9E-701313IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MDDEGRLDIR HWDTLEQSVK DHPGLKFMSV LAERDAAILE RNTAFSEKKA AFAEKETAIF  60
QRDVAYADRN TAILERDAAA AALNYARDGG WNGQRSLTCG TLSNAKILQV LAENPTFSAR  120
EYQTMRPINV AYPASVLETL PFEEAQKTAK RTSKKKDGEK ESPSKRKSDG SEPKSLRQKK  180
QRKPSGTTEE GLNGEVTVVK KEQKNLDVVI NGIXLIFQLC LFLFALALEW LNNVTGGGNG  240
GWQSACCTTS ISMYPLPMNP NRRGARVAGR KMSGGAFRKL LERLGAEGFN LNYPIDLKSY  300
WAKHGTNKFV TIR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.188190.0root
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLH1ZN570.0H1ZN57_PINTA; GAGA-binding transcriptional activator
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.12e-43basic pentacysteine 6