PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002821
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family BBR-BPC
Protein Properties Length: 313aa    MW: 34812.4 Da    PI: 9.9499
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-49390PU_refplantGDBView CDS
gnl|UG|Pta#S25803320PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
  GAGA_bind   1 mdddgsre.rnkgyyepaaslkenlglqlmssiaerdakirernlalsekkaavaerdmaflqrdkalaernkalverdnkllalllvensla.salpvg 98 
                mdd+g  + r++   e++  +k++ gl+ ms++aerda+i ern+a+sekkaa+ae++ a  qrd a a+rn a++erd +++al +++++    + + +
                9************98887..******************************************************************99998764667789 PP

  GAGA_bind  99 vqvlsgtksidslqqlse......pqledsave.lreeeklealpieeaaeeakekkkkkkrqrakkpkekkakkkkkksekskkkvkkesader..... 186
                +++ls++k ++ l +         + +   +++ +   + le+lp eea+++ak+++kkk +++++  k+k   ++ k s  +kk+ k++++ e+     
                9*******9998887333344432222..2222245556666677666666666655555444443333333332222.222223333333223367788 PP

  GAGA_bind 187 ...skaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydlsnpv 283
                   +k+e+k++d+v+ng+ l               l      GnGGWqSaCCtt+iS+yPLP++++rrgaR+agrKmS+gaf+klLe+L aeG++l+ p+
                888****************97776666667777889999999********************************************************** PP

  GAGA_bind 284 DLkdhWAkHGtnkfvtir 301
  Pta002821 296 DLKSYWAKHGTNKFVTIR 313
                *****************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012265.4E-781313IPR010409GAGA-binding transcriptional activator
PfamPF062171.9E-701313IPR010409GAGA-binding transcriptional activator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016021Cellular Componentintegral component of membrane
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLH1ZN570.0H1ZN57_PINTA; GAGA-binding transcriptional activator
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42520.12e-43basic pentacysteine 6