PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta002097
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 360aa    MW: 40835.8 Da    PI: 4.4897
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-14523PU_refplantGDBView CDS
gnl|UG|Pta#S26635777PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.23.3e-4971401128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLp..kkvkaeekewyfFsk.rdkkyatgkrknratksgyWkatgkdkevl 93 
                lppGfrFhPtdeelv++yL+kk++++k     +  + i+++d+yk+eP+dL   +++++++++w+fF++ ++kky++g+rknrat+ gyWk+tgkd++vl
  Pta002097   7 LPPGFRFHPTDEELVWYYLRKKLSNSKseleSDYLNPITDIDLYKYEPSDLAarACFQGRDQQWFFFTEgNRKKYPNGSRKNRATEGGYWKTTGKDRPVL 106
                79**********************9995544444457**************84348889999*****983567899************************ PP

        NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                s +g +vg+kktLvf++gr++++e+t+Wvmheyrl
  Pta002097 107 S-RGVTVGMKKTLVFHRGRSSRAERTSWVMHEYRL 140
                *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-545164IPR003441NAC domain
PROSITE profilePS5100554.2197164IPR003441NAC domain
PfamPF023658.3E-288140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
XGDLNCLPPG FRFHPTDEEL VWYYLRKKLS NSKSELESDY LNPITDIDLY KYEPSDLAAR  60
ACFQGRDQQW FFFTEGNRKK YPNGSRKNRA TEGGYWKTTG KDRPVLSRGV TVGMKKTLVF  120
HRGRSSRAER TSWVMHEYRL VHGEAGESSL LEKDHFVLCR VFLKSGSGAK TCEQHGVSLS  180
REDSRSTDNQ SALVTENKQY DDVILPSSGE GEVEETYSLL KPLTATSEEN TIPWDGDHLS  240
KFLLECLKEP DNDQAACDSL QVPVGADEWS GLINDPFPEV EGVNTLADEV DILIRNDTHE  300
QSSTDQNLHT ERNVHRVDYI DEANITEQSN FEELFSPAYL GGDFLELNDL ISPLDSDFLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A8e-44716515169Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.34300.0root| xylem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010694513.13e-61PREDICTED: NAC domain-containing protein 78
TrEMBLA0A3G6JCL00.0A0A3G6JCL0_PINTA; NAC domain-containing protein 53
STRINGXP_010694513.11e-60(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10500.18e-55NAC domain containing protein 53