PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta000237
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 788aa    MW: 87430.6 Da    PI: 4.8568
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-66582553PU_refplantGDBView CDS
gnl|UG|Pta#S25633589PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM85.11.3e-2626663128
        NAM  63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                +rd+ky++g+r+nrat++gyWkatgkd++v+s +++++g+kktLvfy grap ge+tdWvmhey+l
  Pta000237   2 PRDRKYPNGSRTNRATEAGYWKATGKDRKVTS-QRSTIGTKKTLVFYMGRAPFGERTDWVMHEYHL 66 
                689*****************************.8899****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.936188IPR003441NAC domain
SuperFamilySSF1019419.55E-31288IPR003441NAC domain
PfamPF023651.3E-111066IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
XPRDRKYPNG SRTNRATEAG YWKATGKDRK VTSQRSTIGT KKTLVFYMGR APFGERTDWV  60
MHEYHLDEKE CQAAGLQDSF VLCRVVKKNG LGTKSDDQSV APTEKNDSDG ANNNTLPGNL  120
AETFCTGHQS PVLQEGENKS NLKLPSETSS ENLNDMNEES VERWLDILLD DPDQNCSITS  180
PAELTNNAKV DTAQEIQEVI SSPLNWVQDF NWIPAGVDFN TPGDLEHLQF PNTXGNIEEA  240
EIIEEIFHTA QASQEYNIEA NSWLLSDYLD EIWGGEEFRD EYHDTSMVQT GNHTNPEVTG  300
IQLRQRSQIC QQELPYQGTA MKRVRMQKYP VQHSAIEHQQ DGCTAYSEND CIYDLQEQHI  360
LLDSFNRQNH NSKNMTPLQD PVPLASARQI DAIREGHSPY HLRGPLANES LGKNRQKAHS  420
GRGVGSSFSR DNCQPGTSSM GFRQANEYKF NFPLHDSVME GELSASDLAD KVTVNHVISS  480
MPPQSLIYGL FLNSQSSEIV DIPAESPNQT MKHEPGNSLE IWKSQQQVLT SLTEDKMPFS  540
KINHQTSLSE DGLLSTVAVI KEHEFVPSED DSETPDQFGE PIKGSSSGEV PDSSGASSKV  600
VHPEKILPAP SSSEPTSVRG WKISQRILKF CSSIPSYAAP VMEYLGRFNP KKAILPSEFA  660
CNFGPTDGVT DSAGNMGTCM CTEGNMEHAR SNIFLSQLKQ RVKPKVKSVM PDSGEESGDA  720
MKMFCHRCAD QSNSATLHGL EPPSGVLNGF SEFWNRCAPT SSTSVIVSVC LLGTTSLLFL  780
FLLFRAIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-2629481174NAC domain-containing protein 19
3swm_B4e-2629481174NAC domain-containing protein 19
3swm_C4e-2629481174NAC domain-containing protein 19
3swm_D4e-2629481174NAC domain-containing protein 19
3swp_A4e-2629481174NAC domain-containing protein 19
3swp_B4e-2629481174NAC domain-containing protein 19
3swp_C4e-2629481174NAC domain-containing protein 19
3swp_D4e-2629481174NAC domain-containing protein 19
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.7000.0root| shoot| xylem
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.18e-41NAC domain containing protein 28