PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta000087
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family NAC
Protein Properties Length: 276aa    MW: 30190 Da    PI: 5.9554
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-36323PU_refplantGDBView CDS
gnl|UG|Pta#S26629469PU_unrefUnigeneView CDS
PUT-157a-Pinus_taeda-36324PU_unrefplantGDBView CDS
PUT-157a-Pinus_taeda-36326PU_unrefplantGDBView CDS
PUT-157a-Pinus_taeda-62982548PU_unrefplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1531.3e-47151442128
        NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk....kg 97 
                 +GfrFhPtdeel+++yL+kkv+++ l++ ++i++vd y+++PwdLp+k+  +e+ewyfFs+rd++y++g r+nra+ sgyWkatg+d +++s     + 
  Pta000087  15 LVGFRFHPTDEELITHYLEKKVSSSALPA-SIIADVDPYQHDPWDLPAKALFGENEWYFFSRRDREYPSGARPNRAAGSGYWKATGSDIPIVSMsgstSP 113
                68***************************.89***************8877899**************************************99555545 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                ++vg+kk+ vfykg+  +g+ t+W+mhey l
  Pta000087 114 RKVGVKKSVVFYKGKGGEGVMTNWIMHEYCL 144
                55***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5510168IPR003441NAC domain
PROSITE profilePS5100552.72514169IPR003441NAC domain
PfamPF023652.1E-2516144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MEGVAFQQQA VPELLVGFRF HPTDEELITH YLEKKVSSSA LPASIIADVD PYQHDPWDLP  60
AKALFGENEW YFFSRRDREY PSGARPNRAA GSGYWKATGS DIPIVSMSGS TSPRKVGVKK  120
SVVFYKGKGG EGVMTNWIMH EYCLAQTLPT QKEGSVPLDG CVLCRLFQRL NHSPEMLSSS  180
QLEVPSPSAT DVQRTRQKPA MPKFSSFSRV LLNEVPSMEN LPSHATSDAN NAAVSSAESA  240
SSPQLDDWVL CRLLQTDSFS GDGLVLTAGG PVTVSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A7e-581716923168NAC domain-containing protein 19
3swm_B7e-581716923168NAC domain-containing protein 19
3swm_C7e-581716923168NAC domain-containing protein 19
3swm_D7e-581716923168NAC domain-containing protein 19
3swp_A7e-581716923168NAC domain-containing protein 19
3swp_B7e-581716923168NAC domain-containing protein 19
3swp_C7e-581716923168NAC domain-containing protein 19
3swp_D7e-581716923168NAC domain-containing protein 19
3ulx_A8e-5831712170Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.12960.0cone| embryo| root| xylem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}.
UniprotTISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}.
UniProtTranscription factor that binds to the promoter of ACO5, an ACC oxidase involved in ethylene biosynthesis. Mediates waterlogging-induced hyponastic leaf movement, and cell expansion in abaxial cells of the basal petiole region, by directly regulating the expression of ACO5 (PubMed:24363315). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269|PubMed:18849494, ECO:0000269|PubMed:24363315}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By root flooding (PubMed:24363315). Induced by senescence (PubMed:24659488). {ECO:0000269|PubMed:24363315, ECO:0000269|PubMed:24659488}.
UniProtINDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017257164.15e-69PREDICTED: NAC transcription factor 25-like
SwissprotQ84TD62e-64NAC47_ARATH; NAC transcription factor 47
SwissprotQ8H4S44e-64NAC10_ORYSJ; NAC domain-containing protein 10
TrEMBLD5ABS01e-108D5ABS0_PICSI; Uncharacterized protein
STRINGEOY283341e-66(Theobroma cacao)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Hofmann NR
    A NAC transcription factor for flooding: SHYG helps plants keep their leaves in the air.
    Plant Cell, 2013. 25(12): p. 4771
    [PMID:24363314]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]