PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Psi012251
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Nin-like
Protein Properties Length: 837aa    MW: 92517 Da    PI: 6.9408
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-183a-Picea_sitchensis-18814PU_refplantGDBView CDS
gnl|UG|Psi#S55422340PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK92.92.3e-29372422252
     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                ek+isle+l++yF++++kdAAk++gvc+T+LKriCRq+GI+RWP+Rki+++
  Psi012251 372 EKTISLEVLQQYFAGSLKDAAKNIGVCPTTLKRICRQHGISRWPSRKINKV 422
                799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.268361442IPR003035RWP-RK domain
PfamPF020421.3E-25374422IPR003035RWP-RK domain
SuperFamilySSF542772.71E-23739826No hitNo description
PROSITE profilePS5174519.989741815IPR000270PB1 domain
SMARTSM006663.0E-22741823IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.6E-23744823No hitNo description
PfamPF005644.5E-16744820IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
XGVGVVELVM TAQKINYAPE VEKVCRALQA VNLRSSEILD HPQVQFLRHI NCHWLRLGFH  60
AGIETSSLPG VARRKIVRVL MEVAWDKSXM STIDSAFYVI DAHMWGFRDA CTEHHLQKGQ  120
GLPGKAFASN QPSFSNDISS FSKTEYPLVH YARLFNLAAA VAIRLRSTHT GNDDYILEFF  180
LPTDCKDSQN LQMLLKSVSV TMRHVCQSLR MLTDKELEDE KLLEVSKEFE SFDCQNEFPE  240
DGNGQIVIIF QGYLQNCKFL QGAEFVQCQE RKQIVRQDSF QQALQAGSEG DQNEIQMVQH  300
PITSLPFVSC QKQQPELEGS NLSDLKHHRH ESAQINKEIS AVLANDDILC SGSLQEHTNI  360
RKGLEKKRGK MEKTISLEVL QQYFAGSLKD AAKNIGVCPT TLKRICRQHG ISRWPSRKIN  420
KVNRSLKKLQ GVIESVKGVG AFKIGNLSTG LVSAATVPNT SSVHGKSSPA VVQGAANHDL  480
DMVPPPSNEE VIGIKTSLPG KDCIMPEDFS SSQCQVIATL GTSLSSRLQS IKPGSTHIFQ  540
ETYSVGHAVH VKDVTLDENT NGNLHRVENG HVSYVHGATN GISESRNSES PQESIRTPSS  600
QASHPDLCQI YLNSIEDHAG PPTITAFSRP PASQCHGGGE NLMSQLEFIN NGETSLHKRQ  660
ATSSILKNTH SETAVNCKRK KLPVESSSDQ KPTDFSGQGE CLAEAIQSNS RNLSPQHRCD  720
SRILNLAGLQ RDRIIQEGNK STIFKVTYKQ DTVRFRLPLN AGVSELHDEV TKRFKLEAGT  780
FDLKYLDDDH EWVLLACDAD LQECIGILNL SGGKAIKLVV YDMSSNVGSS CESSGEL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006844913.11e-121protein NLP6
RefseqXP_020523225.11e-121protein NLP6
TrEMBLD5A7X90.0D5A7X9_PICSI; Uncharacterized protein
STRINGERN065881e-120(Amborella trichopoda)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.16e-70Nin-like family protein